T.C. TOKAT GAZİOSMANPAŞA ÜNİVERSİTESİ. Reşadiye Meslek Yüksekokulu Müdürlüğü TERAPİ VE REHABİLİTASYON BÖLÜMÜ FİZYOTERAPİ PROGRAMI

Save this PDF as:

Ebat: px
Şu sayfadan göstermeyi başlat:

Download "T.C. TOKAT GAZİOSMANPAŞA ÜNİVERSİTESİ. Reşadiye Meslek Yüksekokulu Müdürlüğü TERAPİ VE REHABİLİTASYON BÖLÜMÜ FİZYOTERAPİ PROGRAMI"

Transkript

1 T.C. TOKAT GAZİOSMANPAŞA ÜNİVERSİTESİ Reşadiye Meslek Yüksekokulu Müdürlüğü TERAPİ VE REHABİLİTASYON BÖLÜMÜ FİZYOTERAPİ PROGRAMI

2 PROGRAM KILAVUZU İçindekiler GENEL BİLGİLER AKADEMİK TAKVİMİ... 4 ÖĞRENCİ DANIŞMANLARI... ÖĞRETİM ELEMANLARI... PROGRAM YETERLİKLERİ... 6 FİZYOTERAPİ PROGRAMI DERSLERİ... 7 FizyoterapiProgramı. Sınıf Dersleri... 7 Fizyoterapi Programı 2. Sınıf Dersleri... 8 DERSLER VE PROGRAM YETERLİLİKLERİ İLİŞKİSİ... 9 DERS PROGRAMLARI... Birinci Sınıf Güz Dönemi Ders Programı... Birinci Sınıf Bahar Dönemi Ders Programı İkinci Sınıf Güz Dönemi Ders Programı İkinci Sınıf Bahar Dönemi Ders Programı... 6 FİZYOTERAPİ PROGRAMI DERS PLANLARI Sınıf Güz Dönemi Ders Planları Sınıf Bahar Dönemi Ders Planları Sınıf Güz Dönemi Ders Planları Sınıf Bahar Dönemi Ders Planları

3 GENEL BİLGİLER Program Adı Fizyoterapi Programı (Birinci Öğretim) Programın Kısa Tarihçesi Fizyoterapi programı, eğitim- öğretim yılında fizyoterapi teknikeri yetiştirmek amacıyla kurulmuştur. Bünyesinde 3 öğretim görevlisi yer almaktadır. Yaralanmalar, hastalıklar, engeller, kas-iskelet sistemi bozuklukları ve çeşitli hastalıklardan kaynaklı ağrı ve fonksiyon bozukluklarında fizyoterapi uygulamalarına olan ihtiyaç giderek artmaktadır. Tedavilerin başarısında, gereken uygulamaların iyi yetişmiş fizyoterapi teknikerleri tarafından yapılması büyük önem taşımaktadır. Programın Amacı Programın amacı hastalara uygulanan fizik tedavi uygulamalarını, fizik tedavi doktoru ve fizyoterapist denetiminde yapabilecek, bilimsel donanıma sahip insan sağlığına ve etik değerlere önem veren Fizyoterapi Teknikeri yetiştirmektir. Bölüm Başkanı İç Hat: 42 Bölüm Sekreteri Abidin Ünal İç Hat : 42 Mezuniyet Koşulları Ön lisans programına başlayan öğrencilerimizin mezun olabilmesi için Program öğrencileri 4 yarıyıl toplam 2 AKTS (her dönem 3 AKTS) alarak mezun olabilirler. Ayrıca, mezuniyet için öğrencinin 3 iş günü staj yapmış olması gerekmektedir. Ölçme ve Değerlendirme Öğrenciler Gaziosmanpaşa Üniversitesi Ön Lisans ve Lisans Eğitim Öğretim ve Sınav Yönetmeliği hükümlerine tabidir. Öğrenciler herders için en az bir ara sınav bir dönem sonu sınavına girer. Ara sınavın%4 ı, dönem sonu sınavının % 6 ı alınarak yapılan 3

4 değerlendirmesonucunda başarısız olan öğrenciye bütünleme sınavı hakkı verilir. Ayrıca mezuniyet aşamasında bir dersten başarısız olduğu için mezun olamayan öğrencilere tek ders sınav hakkı tanınır. İletişim Çamlıca mahallesi Mimar Sinan caddesi no: Reşadiye/ Tokat Tel: AKADEMİK TAKVİMİ GÜZ Yeni kayıtlar ÖSYM tarafından belirlenecek. sınavlar : 6-2 Eylül Eğitim-Öğretim yılı sonunda azami süreyi aşan ÖNLİSANS öğrencileri için ek sınavlar 2. sınavlar : Eylül 29 Özel öğrenci olarak başka bir üniversitede eğitim almak isteyen öğrencilerimizin son başvuru tarihi Ders kayıtları (internet üzerinden) 9- Eylül 29 Danışman onayı 6-22 Eylül 29 Derslerin Başlaması Kayıt dondurma başvurularının son günü Mazeretli ders kaydı başvurularının son günü..29 Ara sınavlar 9-7 Kasım 29 Derslerin Bitimi Yarıyıl sonu sınavları 4-2 Ocak 22 Yarıyıl sonu sınav sonuçlarının ders sorumlularınca sisteme girilmesi 4- Ocak 22 Bütünleme sınavları 2-26 Ocak 22 Bütünleme sınav sonuçlarının ders sorumlularınca sisteme girilmesi 2-29 Ocak.22 Dönem sonu itibariyle % a giren öğrencilerin tespiti Tek ders sınavı.2.22 Telafi :29 Ekim 29 Dersleri 2 Kasım 29 Cumartesi günü, Ocak 22 Dersleri ise 28 Aralık 29 Cumartesi günü yapılacaktır. BAHAR. sınavlar : 3-7 Şubat Eğitim-Öğretim yılı güz yarı yılı sonunda azami süreyi aşan ÖNLİSANS öğrencileri için ek sınavlar 2.sınavlar : -4 Şubat 22 Özel öğrenci olarak başka bir üniversitede eğitim almak isteyen öğrencilerimizin son başvuru tarihi Ders kayıtları (internet üzerinden) 27 Ocak - 2 Şubat 22 Danışman onayı 3-9 Şubat 22 Derslerin Başlaması.2.22 Kayıt dondurma başvurularının son günü Mazeretli ders kaydı başvurularının son günü Ara sınavlar 28 Mart - Nisan 22 Derslerin Bitimi Yarıyıl sonu sınavları 3 Mayıs - 7 Haziran 22 Yarıyıl sonu sınav sonuçlarının ders sorumlularınca sisteme girilmesi 3 Mayıs - Haziran 22 Bütünleme sınavları -2 Haziran 22 Bütünleme sınav sonuçlarının ders sorumlularınca sisteme girilmesi -24 Haziran 22 Dönem sonu itibariyle % a giren öğrencilerin tespiti Tek ders sınavı.7.22 Telafi :23 Nisan 22 Dersleri 2 Nisan 22 Cumartesi günü, Mayıs 22 Dersleri ise 2 Mayıs 22 Cumartesi, 9 Mayıs 22 Dersleri ise 6 Mayıs 22 Cumartesi günü yapılacaktır. 4

5 . Sınıf 2. Sınıf İç Hat:42 İç Hat: 42 ÖĞRENCİ DANIŞMANLARI Artık Yıl İç Hat: 42 İç Hat:42 İç Hat: 42 Elif BAYAZIT İç hat : 42 ÖĞRETİM ELEMANLARI

6 PROGRAM YETERLİLİKLERİ PY Fizyoterapi Programı, sık karşılaşılan özürler, aktivite limitasyonları ve yaşa bağlı kısıtlılıklarla sonuçlanan durumlara yönelik etkin fizyoterapiyi sağlama becerisi kazandırır. PY2 Fizyoterapi Programı, bilimin temel ilkelerini teknoloji ile birleştirerek, fizik tedavi ve rehabilitasyon alanında etkili uygulama becerisi kazandırır. PY3 Fizyoterapi Programı, kas ve kemik sistemleri hakkında açıklamalar verirken, bu sistemlerde tedavi yöntemleri becerisi kazandırır. PY4 Fizyoterapi Programı, bilişim teknolojilerini ve özel ihtisas gerektiren cihazları etkin kullanma becerisi kazandırır. PY PY6 PY7 Hastalar ve hasta yakınlarının psikolojik durumlarını anlama ve vaziyete göre strateji geliştirme becerisi kazandırır. Fizyoterapi Programı, bireysel çalışma, Tarih bilgisi, yabancı dil bilgisi, yazılı ve sözlü iletişim becerisi kazandırarak, kaynak araştırması, bilgiye erişme ve bilgi kaynaklarını doğru kullanabilme yeteneği sunar. Fizyoterapi Programı, bilim ve teknolojide meydana gelen yenilik, değişim ve gelişimleri takip ederek bunları bütünleşik bir yaklaşımla analiz edebilme becerisi sunar. PY8 Hasta hakları, tıpta etik ve çalışanların yükümlülüklerini açıklama becerisi kazanır. PY9 Fizyoterapi Programı, Terapi ve rehabilitasyon alanında faaliyet gösteren özel ve kamu kuruluşlarında, görev alabilecek bilgiye sahip ara eleman yetişmesini sağlar. PY PY PY2 Fizyoterapi Programı, yaşam boyu nin gerekliliği ve sorumluluk alma özgüveni kazandırarak, toplum önünde fikrini savunacak mesleki donanıma sahip olma becerisi sunar Fizik tedavi ve tıp dünyasının gelişimlerini ve bu doğrultuda sahip olduğu bilgilerin önemini kavrayabilme, yaratıcılık ve yaratıcı düşünce kavramlarını geliştirebilme, mesleki etkinliklerinin uygulandığı alanlardaki etkisini fark edebilme becerisine sahip olma. Çevre duyarlılığı, toplumsal duyarlılık geliştirmiş, farklılıklara saygı gösteren, farklı durumlara ve sosyal rollere uyum gösteren kişilik özellikleri geliştirme. 6

7 TERAPİ VE REHABİLİTASYON BÖLÜMÜ 2. Yarıyıl (BaharDönemi) Dersleri DersKodu DersAdı DersSaati DersiVerenÖğretimÜyeleri FİZYOTERAPİ PROGRAMI.SINIF DERSLERİ D 6 D 94 ZSEÇ- FTP- FTP- 3 FTP- FTP- 7 FTP- 9 FTP- FTP- 9 D 3 D 29 D 4 D 7 D 9 ZSEÇ- 2 FTP- 6 FTP- 4 FTP- 8 FTP- 8 FTP- 2 ATATÜRK İLKELERİ VE İNKILAP TARİHİ I Teorik TÜRK DİLİ I 2 ZORUNLU SEÇMELİ DERSLER(YABANCI DİL) ANATOMİ 3 FİZYOLOJİ 3 MİKROBİYOLOJİ 2 FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME TEMEL FİZİK 2 TIBBİ TERMİNOLOJİ 3 FİZİK TEDAVİ YÖNTEMİ I 2 ALMANCA I (SEÇMELİ DERS) 3 FRANSIZCA I (SEÇMELİ DERS) 3 İNGİLİZCE I (SEÇMELİ DERS) 3 ATATÜRK İLKELERİ VE İNKILAP TARİHİ II Teorik TÜRK DİLİ II 2 ZORUNLU SEÇMELİ DERSLER(YABANCI DİL) TEMEL BİLGİ TEKNOLOJİLERİ 2 FİZYOTERAPİDE KLİNİK KAVRAMLAR FİZİK TEDAVİ YÖNTEMİ II 3 ORTEZ-PROTEZ VE YARDIMCI CİHAZLAR SPOR VE EGZERSİZ FİZYOLOJİSİ 2 Uygulama 2 Ayşe ERYAMAN Yalçın KULAÇ Oğuzhan SÖNMEZ Uygulama Ayşe ERYAMAN Yalçın KULAÇ Oğuzhan SÖNMEZ UğurÇİĞDEM 7

8 FTP- 2 FTP- 4 D 4 D 3 D 4 TIBBI DÖKÜMANTASYON 2 SAĞLIK PSİKOLOJİSİ 2 ALMANCA II(SEÇMELİ DERS) 3 FRANSIZCA II(SEÇMELİ DERS) 3 İNGİLİZCE II(SEÇMELİ DERS) 3 Elif BAYAZIT FİZYOTERAPİ PROGRAMI 2.SINIF DERSLERİ 8

9 DERSLER VE PROGRAM YETERLİLİKLERİ İLİŞKİSİ 3. Yarıyıl (GüzDönemi) Dersleri DersKo DersSa DersiVerenÖğretimÜyeleri Ders Kodu du ati Teorik Uygulama ROMATİZMAL HASTALIKLAR VE FTP-2 3 FİZYOTERAPİ ORTOPEDİK HASTALIKLAR VE FTP-23 3 FİZYOTERAPİ NÖROLOJİK HASTALIKLAR VE FTP-2 3 FİZYOTERAPİ FTP-27 KARDİYO-PULMONER 3 HASTALIKLAR VE FİZYOTERAPİ YAŞLILARDA HASTALIKLAR VE FTP-29 3 FİZYOTERAPİ FTP-229 MESLEKİ YABANCI DİL (SEÇ.DERS) 2 Emrah ÇEVİK ARAŞTIRMA YÖNTEM VE Alptekin DEVELİ FTP-23 2 TEKNİKLERİ(SEÇ.DERS) FTP-29 KİNEZYOLOJİ(SEÇ.DERS) 2 FTP-22 HASTALIKLAR BİLGİSİ(SEÇ.DERS) FTP-223 FARMAKOLOJİ(SEÇ.DERS) FTP-22 MASAJ(SEÇ.DERS) 2 FTP-227 İŞ VE UĞRAŞI(SEÇ.DERS) 2 FTP-23 İLETİŞİM(SEÇ.DERS) 2 2 DARICI 4. Yarıyıl (BaharDönemi) Dersleri DersKo DersSa DersiVerenÖğretimÜyeleri DersAdı du ati Teorik Uygulama FTP-22 HİDROTERAPİ-BALNEOTERAPİ 2 FTP-22 ELEKTROTERAPİ 3 FTP-28 İLK YARDIM 2 Elif BAYAZIT FTP-24 MESLEKİ UYGULAMA 6 ÜNİVERSİTE SEÇMELİ DERSİ USD- 2 HAVUZU FTP-22 SAĞLIK SOSYOLOJİSİ 2 FTP-23 MESLEKİ YABANCI DİL II 2 Emrah ÇEVİK FTP-26 AKUATİK REHABİLİTASYON ÇOCUK HASTALIKLARI VE FTP FİZYOTERAPİ FTP-22 PSİKOSOSYAL REHABİLİTASYON 2 Elif BAYAZIT FTP-222 HASTA HAKLARI FTP-224 SAĞLIK TURİZMİ FTP-228 TIBBİ DEONTOLOJİ VE ETİK 2 Elif BAYAZIT DİJİTAL İLETİŞİM VE HALKLA FTP İLİŞKİLER 9

10 .Yarıyıl Ders Planı Ders Adı P P 2 P 3 P 4 P P 6 P 7 P 8 P 9 P P P 2 D6 ATATÜRK İLKELERİ VE İNKILAP TARİHİ I D94 TÜRK DİLİ I ZSEÇ- ZORUNLU SEÇMELİ DERSLER(YABANCI DİL) FTP- ANATOMİ FTP-3 FİZYOLOJİ FTP- MİKROBİYOLOJİ FTP-7 FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME FTP-9 TEMEL FİZİK FTP- TIBBİ TERMİNOLOJİ FTP-3 FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Yarıyıl DersPlanı DersKo du DersAdı P P2 P3 P4 P P6 P7 P8 P9 P P P2 D7 ATATÜRK İLKELERİ VE İNKILAP TARİHİ II 4 4 D9 TÜRK DİLİ II ZSEÇ-2 ZORUNLU SEÇMELİ DERSLER(YABANCI DİL) FTP-2 TEMEL BİLGİ TEKNOLOJİLERİ FTP-4 FİZYOTERAPİDE KLİNİK KAVRAMLAR FTP-6 FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ II FTP-8 ORTEZ-PROTEZ VE YARDIMCI CİHAZLAR FTP- SPOR VE EGZERSİZ FİZYOLOJİSİ FTP-2 TIBBI DÖKÜMANTASYON FTP-4 SAĞLIK PSİKOLOJİSİ

11 FTP-7 FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME FTP-9 TEMEL FİZİK FTP- TIBBİ TERMİNOLOJİ FTP-3 FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I YarıyılDersPlanı DersKo du DersAdı P P2 P3 P4 P P6 P7 P8 P9 P P P2 FTP-2 ROMATİZMAL HASTALIKLAR REHABİLİTASYONU FTP-23 ORTOPEDİK REHABİLİTASYON FTP-2 NÖROLOJİK REHABİLİTASYON FTP-27 KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONU FTP-29 YAŞLILARDA REHABİLİTASYON SeçmeliDersHavuzu FTP-2 MESLEKİ İNGİLİZCE I FTP-23 ARAŞTIRMA YÖNTEM VE TEKNİKLERİ FTP-2 İLETİŞİM 4 4 FTP-27 MESLEK ETİĞİ FTP-29 KİNEZYOLOJİ FTP-22 HASTALIKLAR BİLGİSİ FTP-223 FARMAKOLOJİ FTP-22 MASAJ YarıyılDersPlanı DersKo du DersAdı P P2 P3 P4 P P6 P7 P8 P9 P P P2 FTP-22 HİDROTERAPİ-BALNEOTERAPİ FTP-24 İŞİTME VE KONUŞMA TEDAVİSİ FTP-26 ELEKTROTERAPİ FTP-28 İLK YARDIM FTP-2 MESLEKİ UYGULAMA USD- ÜNİVERSİTE SEÇMELİ DERSİ HAVUZU SeçmeliDersHavuzu FTP-22 SAĞLIK SOSYOLOJİSİ FTP-24 MESLEKİ İNGİLİZCE II FTP-26 AKUATİK REHABİLİTASYON FTP-28 ÇOCUK HASTA REHABİLİTASYONU FTP-22 PSİKOSOSYAL REHABİLİTASYON FTP-222 HASTA HAKLARI FTP-224 SAĞLIK TURİZMİ FTP-226 HALKLA İLİŞKİLER * İlişki düzeyleri (yok) ve (en yüksek) arasında ifade edilmiştir

12 8: 9: 9: : : : : 2: Gün/Ay/Yıl Pazartesi Birinci Sınıf Güz Dönemi Ders Programı (BİRİNCİ YARIYIL) Gün/Ay/Yıl Salı. Hafta Gün/Ay/Yıl Çarşamba Gün/Ay/Yıl Perşembe UYUM HAFTASI Gün/Ay/Yıl Cuma 3: 4: 4: : : 6: 6: 7: Birinci sınıf, birinci yarıyıl döneminin ilk haftası uyum haftası olarak yürütülmektedir. Uyum haftası boyunca öğrencilerin uyum süreci, aşağıdaki başlıklar veya belirlenen başka konular çerçevesinde desteklenmelidir; Üniversitenin yerleşim planının tanıtımı Kütüphane, Yemekhane, Sosyal Tesisler vb. hizmet binalarına ziyaret ve bu hizmetlerden yararlanabilmek için ayrıntılı bilgilendirme Öğrenim görülen fakülte binasının tanıtılması Öğrenim görülen programın tanıtımı Öğrenci kulüplerine ilişkin bilgilendirme Öğrenci değişim programlarının tanıtımı (Erasmus, Farabi, Mevlana Değişim programları) Çift Anadal ve Yandal Eğitimine ilişkin bilgilendirme Lisansüstü Eğitime ilişkin bilgilendirme 2. Hafta 8: 9: 9: : : : 3/9/29 Pazartesi Öğrenme FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Fizyoterapiyegirişvepro sedürü FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I //29 Salı TEMEL FİZİK Ölçme, Vektörler 2//2 9 Çarşamba 3//29 Perşembe Atatürk İlkeleriveİnkılapTarihi -I Dersleilgilitemelkavra mlar Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi -I Atatürk üninkılapçılıkil kesi Ayşe Eryaman TIBBİ TERMİNOLOİGiriş, insanyapısınailişkintem 4//29 Cuma //2 9 Cumartes i İngilizce-I Verb to be Öğr. Gör. Oğuzha nsönme z İngilizce-I Verb to be 2

13 Fizyoterapiyegirişvepro sedürü : 2: FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Fizyoterapiyegirişvepro sedürü TEMEL FİZİK Ölçme, Vektörler eltanımveterimler Anatomi AnatomiyeGiriş. Terminoloji. Eksen- DüzlemBilgisi TIBBİ TERMİNOLOİGiriş, insanyapısınailişkintem eltanımveterimler Oğuzhan Sönmez İngilizce-I Subject pronouns Oğuzhan Sönmez 3: 4: 4: : : 6: 6: 7: Fizyoloji FizyolojikPrensiplerveH ücrefizyolojisi Şeyma Fizyoloji FizyolojikPrensiplerveH ücrefizyolojisi Şeyma Fizyoloji FizyolojikPrensiplerveH ücrefizyolojisi Şeyma Türk Dili-I DilKavramıveTürkçeninDün yadilleriarasındakiyeri YalçınKulaç Türk Dili-I DilKavramıveTürkçeninDün yadilleriarasındakiyeri YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Temelölçmevedeğerlendirm e FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Temelölçmevedeğerlendirm e ö ğrenme Anatomi AnatomiyeGiriş. Terminoloji. Eksen- DüzlemBilgisi TIBBİ TERMİNOLOİGiriş, insanyapısınailişkintem eltanımveterimler Mikrobiyoloji MikrobiyolojiyeGiriş Mikrobiyoloji MikrobiyolojiyeGiriş Anatomi AnatomiyeGiriş. Terminoloji. Eksen- DüzlemBilgisi ö ğrenme ö ğrenme ö ğrenme ö ğrenme 3. Hafta 8: 9: 9: : : : : 2: 7//29 Pazartesi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Ağrı FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Ağrı FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Ağrı 8//29 Salı öğre nme öğre nme TEMEL FİZİK Bir veikiboyutluha reketler Mehmet TEMEL FİZİK Bir veikiboyutluha reketler 9//29 Çarşamba ö ğrenme ö ğrenme //29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I Osmanlılarıngerilemesininiç sebepleri Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I Osmanlılarıngerilemesininiç sebepleri Ayşe Eryaman TIBBİ TERMİNOLOİTıbbiterimlerim eydanagetirenöğeler; kökler, önekler, son ekler Anatomi HareketSistemi, ÜstEkstremiteKemikveEkle mleri //29 Cuma TIBBİ TERMİNOLOİTıbbiterimlerim eydanagetirenöğeler; kökler, önekler, son ekler 2//29 Cumartesi İngilizce-I Possessive adjectives, object pronouns, family members Oğuzhan Sönmez İngilizce-I Possessive adjectives, object pronouns, family members OğuzhanS önmez İngilizce-I Possessive adjectives, object pronouns, 3

14 Mehmet family members OğuzhanS önmez 3: 4: 4: : : 6: 6: 7: Fizyoloji Dokular, Düz Kas veiskeletkasıişlevlerim ekanizması Şeyma Fizyoloji Dokular, Düz Kas veiskeletkasıişlevlerim ekanizması Şeyma Fizyoloji Dokular, Düz Kas veiskeletkasıişlevlerim ekanizması Şeyma Türk Dili-I YapıveKökenB akımından Diller YalçınKulaç Türk Dili-I YapıveKökenB akımından Diller YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİR ME Hareketinteme lprensipleri Mehmet FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİR ME Hareketinteme lprensipleri Mehmet ö ğrenme ö ğrenme ö ğrenme ö ğrenme Anatomi HareketSistemi, ÜstEkstremiteKemikveEkle mleri TIBBİ TERMİNOLOİTıbbiterimlerim eydanagetirenöğeler; kökler, önekler, son ekler Mikrobiyoloji Mikroskoplar, MikrobiyolojideKullanılanDiğ eraraç,gereçvecihazlar Mikrobiyoloji Mikroskoplar, MikrobiyolojideKullanılanDiğ eraraç,gereçvecihazlar Anatomi HareketSistemi, ÜstEkstremiteKemikveEkle mleri ö ğrenme ö ğrenme ö ğrenme ö ğrenme 4. Hafta 8: 9: 9: : : : : 4//29 Pazartesi öğ renme FİZİK TEDAVİ VE REHABİLİT ASYON YÖNTEMİ I Sıcakvesoğ uk Mehmet FİZİK TEDAVİ VE REHABİLİT ASYON YÖNTEMİ I Sıcakvesoğ uk Mehmet FİZİK TEDAVİ VE //29 Salı TEMEL FİZİK Newton kanunları TEMEL FİZİK Newton kanunları 6//29 Çarşamba öğ renme öğ renme öğ renme öğ renme 7//29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I Osmanlılarıngerilemesinindışse bepleri Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I Osmanlılarıngerilemesinindışse bepleri Ayşe Eryaman TIBBİ TERMİNOLOİİskeletsistemitıbbi terimler Anatomi HareketSistemi,AltEkstremiteK 8//29 Cuma TIBBİ TERMİNOLOİİskeletsistemitıbbi 9//29 Cumartesi ö ğrenme İngilizce-I Numbers, Days and Months OğuzhanS önmez İngilizce-I Numbers, Days and Months OğuzhanSö nmez İngilizce-I Numbers, 4

15 2: REHABİLİT ASYON YÖNTEMİ I Sıcakvesoğ uk Mehmet emikveeklemleri terimler Days and Months OğuzhanSö nmez 3: 4: 4: : : 6: 6: 7: Fizyoloji Asit Baz Dengesi Şeyma Fizyoloji Asit Baz Dengesi Şeyma Fizyoloji Asit Baz Dengesi Şeyma öğ renme Türk Dili-I Dil-Kültürİlişkisi, DilinToplumHayat ındakiyeri YalçınKulaç Türk Dili-I Dil-Kültürİlişkisi, DilinToplumHayat ındakiyeri YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Goniometrikölçüm ler FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Goniometrikölçüm ler öğ renme öğ renme öğ renme öğ renme Anatomi HareketSistemi,AltEkstremiteK emikveeklemleri TIBBİ TERMİNOLOİİskeletsistemitıbbi terimler Mikrobiyoloji BakterilerinYapıVeFizyolojileri Mikrobiyoloji BakterilerinYapıVeFizyolojileri Anatomi HareketSistemi,AltEkstremiteK emikveeklemleri öğr enme öğr enme öğr enme öğr enme.hafta 8: 9: 9: : : : : 2: 2//29 Pazartesi öğren me FİZİK TEDAVİ VE REHABİLİTASY ON YÖNTEMİ I Yüzeyselsıcakl ar Mehmet FİZİK TEDAVİ VE REHABİLİTASY ON YÖNTEMİ I Yüzeyselsıcakl ar Mehmet FİZİK TEDAVİ VE REHABİLİTASY ON YÖNTEMİ I 22//29 Salı öğren me öğren me TEMEL FİZİK İş, Güç, Enerji Mehmet TEMEL FİZİK İş, Güç, Enerji Mehmet 23//29 Çarşamba öğr enme öğr enme öğr enme öğr enme 24//29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I Çağdaşdünyanıntemelkavram ları Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I Çağdaşdünyanıntemelkavram ları Ayşe Eryaman TIBBİ TERMİNOLOİSolunumsistemitı bbiterimler Anatomi HareketSistemi, Skeleton Axiale, Eklemleri, BaşveGövdeKasları 2//29 Cuma TIBBİ TERMİNOLOİSolunumsistemitı bbiterimler 26//29 Cumartesi öğr enme İngilizce-I Countries OğuzhanSön mez İngilizce-I Prepositions OğuzhanSön mez İngilizce-I Prepositions OğuzhanSön

16 Yüzeyselsıcakl ar Mehmet mez 3: 4: 4: : : 6: 6: 7: Fizyoloji SıvıElektrolitD engesi Şeyma Fizyoloji SıvıElektrolitD engesi Şeyma Fizyoloji SıvıElektrolitD engesi Şeyma öğren me Türk Dili-I Noktalamaİşa retleri YalçınKulaç Türk Dili-I Noktalamaİşa retleri YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİR ME Postüranalizi Mehmet FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİR ME Postüranalizi Mehmet öğr enme öğr enme öğr enme öğr enme Anatomi HareketSistemi, Skeleton Axiale, Eklemleri, BaşveGövdeKasları TIBBİ TERMİNOLOİSolunumsistemitı bbiterimler Mikrobiyoloji BakteriGenetiğiVeAntimikrobi kmaddeler Mikrobiyoloji BakteriGenetiğiVeAntimikrobi kmaddeler Anatomi HareketSistemi, Skeleton Axiale, Eklemleri, BaşveGövdeKasları öğre nme öğre nme öğre nme öğre nme 8: 9: 9: : : : 28//29 Pazartesi öğ renme FİZİK TEDAVİ VE REHABİLİT ASYON YÖNTEMİ I İnfarujve Hot Pack Mehmet FİZİK TEDAVİ VE REHABİLİT ASYON YÖNTEMİ I İnfarujve Hot Pack Mehmet 29//29 Salı öğr enme öğr enme TEMEL FİZİK Enerjininkor unumu Mehmet 3//29 Çarşamba öğ renme öğ renme öğ renme 6. Hafta 3//29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletindeyenileşmeh areketleri Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletindeyenileşmeh areketleri Ayşe Eryaman TIBBİ TERMİNOLOİKardiovaskülersist emtıbbiterimler //29 Cuma 2//29 Cumartesi ö ğrenme İngilizce-I A / An & Plural Nouns OğuzhanS önmez İngilizce-I A / An & Plural Nouns OğuzhanSö nmez : FİZİK TEMEL FİZİK öğ Anatomi TIBBİ İngilizce-I 6

17 2: TEDAVİ VE REHABİLİT ASYON YÖNTEMİ I İnfarujve Hot Pack Mehmet Enerjininkor unumu Mehmet renme HareketSistemi, Alt veüstekstremitekasları TERMİNOLOİKardiovaskülersistemtıb biterimler A / An & Plural Nouns OğuzhanSö nmez 3: 4: 4: : : 6: 6: 7: Fizyoloji Kan FizyolojisiÖ ğr. Gör. Şeyma Fizyoloji Kan FizyolojisiÖ ğr. Gör. Şeyma Fizyoloji Kan FizyolojisiÖ ğr. Gör. Şeyma öğ renme Türk Dili-I YazımKurall arı YalçınKulaç Türk Dili-I YazımKurall arı YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLEND İRME Anterior analiz Mehmet FİZİK TEDAVİDE ÖLÇME VE DEĞERLEND İRME Anterior analiz Mehmet öğ renme öğ renme öğ renme öğ renme Anatomi HareketSistemi, Alt veüstekstremitekasları TIBBİ TERMİNOLOİKardiovaskülersistemtıb biterimler Mikrobiyoloji MikroorganizmalarınÜretildiğiOrtamla rvetanımlanmaları Mikrobiyoloji MikroorganizmalarınÜretildiğiOrtamla rvetanımlanmaları Anatomi HareketSistemi, Alt veüstekstremitekasları öğr enme öğr enme öğr enme öğr enme 7. Hafta 8: 9: 9: : : : 4//29 Pazartesi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Parafin Mehmet FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Parafin Mehmet //29 Salı TEMEL FİZİK Momentumunkorun umu 6//29 Çarşamba öğr enme öğr enme öğr enme 7//29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletindeyenileşme hareketleri Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletindeyenileşme hareketleri Ayşe Eryaman TIBBİ TERMİNOLOİ Kulak, buru,boğaz, Göztıbbiterimler 8//29 Cuma 9//29 Cumartesi öğr enme İngilizce-I The Simple Present Tense I ( I / you / we / they) OğuzhanSön mez İngilizce-I The Simple Present Tense I ( I / you / we / they) 7

18 : 2: FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Parafin Mehmet TEMEL FİZİK Momentumunkorun umu öğr enme Anatomi SolunumSistemiAnatomisi TIBBİ TERMİNOLOİ Kulak, buru,boğaz, Göztıbbiterimler OğuzhanSön mez İngilizce-I The Simple Present Tense I ( I / you / we / they) OğuzhanSön mez 3: 4: 4: : : 6: 6: 7: Fizyoloji DolaşımSistemiFiz yolojisi Fizyoloji DolaşımSistemiFiz yolojisi Fizyoloji DolaşımSistemiFiz yolojisi Türk Dili-I SözcükteveCümled eanlam YalçınKulaç Türk Dili-I SözcükteveCümled eanlam YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Posterior ve lateral analiz FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Posterior ve lateral analiz öğr enme öğr enme öğr enme Anatomi SolunumSistemiAnatomisi TIBBİ TERMİNOLOİ Kulak, buru,boğaz, Göztıbbiterimler Mikrobiyoloji BoyalarVeBoyamaYö ntemleri Çevre Mikrobiyoloji BoyalarVeBoyamaYö ntemleri Anatomi SolunumSistemiAnat omisi öğre nme öğre nme öğre nme öğre nme 8. Hafta 8: 9: 9: : : : : 2: //29 Pazartesi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I DerinIsıtıcılar FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I DerinIsıtıcılar FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I DerinIsıtıcılar 2//29 Salı TEMEL FİZİK Katıcisimlerdekütlem erkezi TEMEL FİZİK Katıcisimlerdekütlem erkezi 3/29 Çarşamba öğre nme öğre nme 4//29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletinin son dönemindekifikirakımlarıdevl etini Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletinin son dönemindekifikirakımlarıdevl etini Ayşe Eryaman TIBBİ TERMİNOLOİÜro- Genital sistemtıbbiterimler Anatomi SindirimSistemiAnatomisi //29 Cuma TIBBİ TERMİNOLOİÜro- Genital sistemtıbbiterimle r Mehmet 6//29 Cumartesi öğre nme İngilizce-I Wh- questions OğuzhanSön mez İngilizce-I Wh- questions OğuzhanSön mez İngilizce-I Wh- questions OğuzhanSön mez 8

19 3: 4: 4: : : 6: 6: 7: Fizyoloji SolunumSistemiFizy olojisi Fizyoloji SolunumSistemiFizy olojisi Fizyoloji SolunumSistemiFizy olojisi Türk Dili-I AnlatımTeknikleri YalçınKulaç Türk Dili-I AnlatımTeknikleri YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Kas testigenelprensipleri FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Kas testigenelprensipleri öğre nme öğre nme öğre nme Anatomi SindirimSistemiAnatomisi TIBBİ TERMİNOLOİÜro- Genital sistemtıbbiterimle r Mehmet Mikrobiyoloji Mikrobiyolojisi, Örnek Alma TeknikleriVe Normal MikrobiyalFloralar Mikrobiyoloji Mikrobiyolojisi, Örnek Alma TeknikleriVe Normal MikrobiyalFloralar Anatomi Uro- Genital SistemAnatomisiÖ ğr. Gör. Şeyma öğre nme öğre nme öğre nme öğre nme 9. Hafta 8: 9: 9: : : : : 2: 8//29 Pazartesi öğren me FİZİK TEDAVİ VE REHABİLİTASY ON YÖNTEMİ I Kısadalgadiater mi Mehmet FİZİK TEDAVİ VE REHABİLİTASY ON YÖNTEMİ I Kısadalgadiater mi Mehmet FİZİK TEDAVİ VE REHABİLİTASY ON YÖNTEMİ I Kısadalgadiater mi Mehmet 9//29 Salı TEMEL FİZİK RotasyonelKinematik vedinamikler TEMEL FİZİK RotasyonelKinematik vedinamikler 2//29 Çarşamba ö ğrenme 2//29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletininyıkılışı Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletininyıkılışı Ayşe Eryaman TIBBİ TERMİNOLOİNörolojikvePsiki yatritıbbiterimler Anatomi KalpveDolaşımSistemiAnato misi 22//29 Cuma TIBBİ TERMİNOLOİNörolojikvePsiki yatritıbbiterimler 23//29 Cumartesi ö ğrenme İngilizce-I Present Simple Tense II OğuzhanS önmez İngilizce-I Present Simple Tense II OğuzhanSö nmez İngilizce-I Present Simple Tense II OğuzhanSö nmez 9

20 3: 4: 4: : : 6: 6: 7: Fizyoloji SindirimSistemi Fizyolojisi Şeyma Fizyoloji SindirimSistemi Fizyolojisi Şeyma Fizyoloji SindirimSistemi Fizyolojisi Şeyma Türk Dili-I ResmiYazışmalar YalçınKulaç Türk Dili-I ResmiYazışmalar YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Üstekstremite kas testleri FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Üstekstremite kas testleri ö ğrenme ö ğrenme ö ğrenme ö ğrenme Anatomi KalpveDolaşımSistemiAnat omisi TIBBİ TERMİNOLOİNörolojikvePsiki yatritıbbiterimler Mikrobiyoloji SterilizasyonVeDezenfeksiyo n Mikrobiyoloji SterilizasyonVeDezenfeksiyo n AnatomiKalpveDolaşımSiste mianatomisi ö ğrenme öğ renme öğ renme öğ renme. Hafta 8: 9: 9: : : : : 2: 2//29 Pazartesi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Kaplıcatedavisi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Kaplıcatedavisi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Kaplıcatedavisi 26//29 Salı öğre nme öğre nme TEMEL FİZİK Işığınözellikler i :yansımavekırı lma Mehmet TEMEL FİZİK Işığınözellikler i :yansımavekırı lma Mehmet 27//29 Çarşamba öğre nme öğre nme öğre nme öğre nme 28//29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletininyıkılışı Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I Osmanlıdevletininyıkılışı Ayşe Eryaman TIBBİ TERMİNOLOİ Gastro- İntestinal sistemtıbbiterimler Anatomi MerkeziSinirSistemiAnatomi si 29//29 Cuma TIBBİ TERMİNOLOİ Gastro-İntestinal sistemtıbbiterimler 3//29 Cumartesi öğre nme İngilizce-I Daily Activities OğuzhanSön mez İngilizce-I Daily Activities OğuzhanSön mez İngilizce-I Daily Activities OğuzhanSön mez 3: 4: 4: Fizyoloji EndokrinSistemFizy olojisi Fizyoloji EndokrinSistemFizy Türk Dili-I ResmiYazışm alar YalçınKulaç Türk Dili-I ResmiYazışm öğre nme öğre nme Anatomi MerkeziSinirSistemiAnato misi TIBBİ TERMİNOLOİ Gastro-İntestinal sistemtıbbiterimler Mikrobiyoloji ImmünolojiyeGirişVeAntije öğren me öğren me 2

21 : : 6: 6: 7: olojisi Fizyoloji EndokrinSistemFizy olojisi alar YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİR ME Alt ekstremite kas testleri Mehmet FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİR ME Alt ekstremite kas testleri Mehmet öğre nme öğre nme n Mikrobiyoloji ImmünolojiyeGirişVeAntije n Anatomi MerkeziSinirSistemiAnato misi öğren me öğren me. Hafta 8: 9: 9: : : : : 2: 2/2/29 Pazartesi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Elektrikakımları Mehmet FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Elektrikakımları Mehmet FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Elektrikakımları Mehmet 3/2/29 Salı TEMEL FİZİK Elektirkselalanveelektrikse lpotansiyel TEMEL FİZİK Elektirkselalanveelektrikse lpotansiyel 4/2/29 Çarşamba öğr enme öğr enme öğr enme öğr enme /2/29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I MillîMücadele Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I MillîMücadele Ayşe Eryaman TIBBİ TERMİNOLOİDermatolitı bbiterimler Anatomi PeriferikSinirSistemiAnat omisi 6/2/29 Cuma TIBBİ TERMİNOLOİ Dermatolitıbbiteriml er 7/2/29 Cumartesi öğ renme İngilizce-I Jobs and related verbs OğuzhanSö nmez İngilizce-I Jobs and related verbs OğuzhanSön mez İngilizce-I Jobs and related verbs OğuzhanSön mez 3: 4: 4: : : 6: Fizyoloji BoşaltımSistemiFi zyolojisi Fizyoloji BoşaltımSistemiFi zyolojisi Fizyoloji BoşaltımSistemiFi zyolojisi Türk Dili-I CümledeYardımcıÖgeler YalçınKulaç Türk Dili-I CümledeYardımcıÖgeler YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Gövdekaslarıtestleri öğr enme öğr enme öğr enme Anatomi PeriferikSinirSistemiAnat omisi TIBBİ TERMİNOLOİ Dermatolitıbbiteriml er Mikrobiyoloji ImmünSistemYapısı Mikrobiyoloji ImmünSistemYapısı öğre nme öğre nme öğre nme 2

22 6: 7: FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Gövdekaslarıtestleri öğr enme Anatomi PeriferikSinirSistemiA natomisi öğre nme 2. Hafta 8: 9: 9: : : : : 2: 9/2/29 Pazartesi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Elektrikakımları FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Elektrikakımları FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Elektrikakımları /2/29 Salı TEMEL FİZİK Akın ohm yasasıvealternatif akımlar Mehmet TEMEL FİZİK Akın ohm yasasıvealternatif akımlar Mehmet /2/29 Çarşamba öğr enme öğr enme öğr enme öğr enme 2/2/29 Perşembe Atatürk İlkeleriveİnkılapTarihi-I MillîMücadele Ayşe Eryaman Atatürk İlkeleriveİnkılapTarihi-I MillîMücadele Ayşe Eryaman TIBBİ TERMİNOLOİ Hematolojitıbbiterimler Anatomi OtonomSinirSistemiAnato misi 3/2/29 Cuma TIBBİ TERMİNOLOİ Hematolojitıbbiterimler 4/2/29 Cumartesi öğr enme İngilizce-I Adjectives OğuzhanSö nmez İngilizce-I Adjectives OğuzhanSön mez İngilizce-I Adjectives OğuzhanSön mez 3: 4: 4: : : 6: 6: 7: Fizyoloji MerkeziSinirSistemiİşle vleri Fizyoloji MerkeziSinirSistemiİşle vleri Fizyoloji MerkeziSinirSistemiİşle vleri Türk Dili-I CümledeTemelÖ geler YalçınKulaç Türk Dili-I CümledeTemelÖ geler YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Antropometrikölç ümler Mehmet FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Antropometrikölç ümler Mehmet öğr enme öğr enme öğr enme öğr enme Anatomi OtonomSinirSistemiAnat omisi TIBBİ TERMİNOLOİ Hematolojitıbbiterimler Mikrobiyoloji ImmunglobulinlerVeImm üncevap Mikrobiyoloji ImmunglobulinlerVeImm üncevap Anatomi OtonomSinirSistemiAnat omisi öğre nme öğre nme öğre nme öğre nme 22

23 3. Hafta 8: 9: 9: : : : : 2: 6/2/29 Pazartesi FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Tens, Enterfarrensiyelakım FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Tens, Enterfarrensiyelakım FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Tens, Enterfarrensiyelakım 7/2/29 Salı TEMEL FİZİK Manyetizmaveelektromanyetiz ma TEMEL FİZİK Manyetizmaveelektromanyetiz ma 8/2/29 Çarşamba öğr enme öğr enme öğr enme öğr enme 9/2/29 Perşembe Atatürk İlkeleriveİnkılapT arihi-i MillîMücadele Ayşe Eryaman Atatürk İlkeleriveİnkılapT arihi-i MillîMücadele Ayşe Eryaman TIBBİ TERMİNOLOİ Endokrinolojitıbbit erimler Mehmet Anatomi DuyuOrganlarıAna tomisi 2/2/29 Cuma TIBBİ TERMİNOLOİ Endokrinolojitıbbit erimler 2/2/29 Cumartesi öğ renme İngilizce-I Parts of the body & Have got / Has got OğuzhanSö nmez İngilizce-I Parts of the body & Have got / Has got OğuzhanSön mez İngilizce-I Parts of the body & Have got / Has got OğuzhanSön mez 3: 4: 4: : : 6: 6: 7: Fizyoloji PeriferikSinirSistemiİşl evler Fizyoloji PeriferikSinirSistemiİşl evler Fizyoloji PeriferikSinirSistemiİşl evler Türk Dili-I DilYanlışlıkları, SözcükDüzeyind edilyanlışları YalçınKulaç Türk Dili-I DilYanlışlıkları, SözcükDüzeyind edilyanlışları YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Kısalikveesnekliktestleri FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Kısalikveesnekliktestleri öğr enme öğr enme öğr enme öğr enme Anatomi DuyuOrganlarıAna tomisi TIBBİ TERMİNOLOİ Endokrinolojitıbbit erimler MikrobiyolojiDoğa ldirenç, AşılarVeBağışıkSer umlar MikrobiyolojiDoğa ldirenç, AşılarVeBağışık Serumlar Anatomi DuyuOrganlarıAna tomisi öğre nme öğre nme öğre nme öğre nme 4. Hafta 8: 9: 23/2/29 Pazartesi 24/2/29 Salı 2/2/29 Çarşamba öğr enme 26/2/29 Perşembe Atatürk İlkeleriveİnkılap Tarihi-I MillîMücadele Ayşe Eryaman 27/2/29 Cuma 28/2/29 Cumartesi öğr enme 23

24 9: : : : : 2: FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Galvanikvefaradika kım Mehmet FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Galvanikvefaradika kım Mehmet FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Galvanikvefaradika kım Mehmet TEMEL FİZİK Manyetizmaveelektromanyetiz ma TEMEL FİZİK Manyetizmaveelektromanyetiz ma öğr enme öğr enme öğr enme Atatürk İlkeleriveİnkılap Tarihi-I MillîMücadele Ayşe Eryaman TIBBİ TERMİNOLOİ Meme hastalıklarıtıbbite rimler Mehmet Anatomi DuyuOrganlarıAn atomisi TIBBİ TERMİNOLOİ Meme hastalıklarıtıbbiteriml er İngilizce-I Activities with ing& like + Verbing OğuzhanSö nmez İngilizce-I Activities with ing& like + Verbing OğuzhanSön mez İngilizce-I Activities with ing& like + Verbing OğuzhanSön mez 3: 4: 4: : : 6: 6: 7: Fizyoloji DuyuSistemiİşlevler i Fizyoloji DuyuSistemiİşlevler i Fizyoloji DuyuSistemiİşlevler i Türk Dili-I DilYanlışlıkları, SözcükDüzeyind edilyanlışları YalçınKulaç Türk Dili-I DilYanlışlıkları, SözcükDüzeyind edilyanlışları YalçınKulaç FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Skolyozdeğerlendirmesi FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME Skolyozdeğerlendirmesi öğr enme öğr enme öğr enme öğr enme Anatomi DuyuOrganlarıAn atomisi TIBBİ TERMİNOLOİ Meme hastalıklarıtıbbiteriml er Mikrobiyoloji MikrobiyolojikTanıYö ntemleri Mikrobiyoloji MikrobiyolojikTanıYö ntemleri Anatomi DuyuOrganlarıAnato misi öğre nme öğre nme öğre nme öğre nme 24

25 8: 9: 9: : : : : 2: 3: 4: 4: : : 6: 6: 7: Gün/Ay/Yıl Pazartesi Birinci Sınıf Bahar Dönemi Ders Programı (İKİNCİ YARIYIL) Gün/Ay/Yıl Salı. Hafta Gün/Ay/Yıl Çarşamba Gün/Ay/Yıl Perşembe UYUM HAFTASI Gün/Ay/Yıl Cuma Birinci sınıf, ikinci yarıyıl döneminin ilk haftası uyum haftası olarak yürütülmektedir. Uyum haftası boyunca öğrencilerin uyum süreci, aşağıdaki başlıklar veya belirlenen başka konular çerçevesinde desteklenmelidir; Öğrenci değişim programlarının tanıtımı (Erasmus, Farabi, Mevlana Değişim programları) Çift Anadal ve Yandal Eğitimine ilişkin bilgilendirme Öğrenci kulüplerine ilişkin bilgilendirme Lisansüstü eğitime ilişkin bilgilendirme Üniversite bünyesinde hizmet veren Kariyer Uygulama Ve Araştırma Merkezi hakkında bilgilendirme 2. Hafta 8: 9: /2/22 Pazartesi /2/2 Salı 2/2/22 Çarşamba TIBBİ DÖKÜMANTASY ON Tıbbidökümantas yonagiriş Mehmet 3/2/22 Perşembe 4/2/22 Cuma öğrenm e /2/22 Cumartesi öğren me 9: : TIBBİ DÖKÜMANTASY ON Tıbbidökümantas yonagiriş Mehmet öğrenm e öğren me : : TEMEL BİLGİ TEKNOLOJİLERİ Windows işletimsistemi, masaüstüortamınıkullanma, SağlıkPsikolojisi PsikolojiyeGiriş Elif Türk Dili-II DersinAmacı, İçeriğiveKaynakla öğrenm e öğren me 2

26 Pencereelemanları, klasörvedosyalarlailgiliseçme, oluşturma, taşımavb.işlemler Öğr.Gör. Uğur ÇİĞDEM : 2: ö ğrenme TEMEL BİLGİ TEKNOLOJİLERİ Windows işletimsistemi, masaüstüortamınıkullanma, Pencereelemanları, klasörvedosyalarlailgiliseçme, oluşturma, taşımavb.işlemler Öğr.Gör. Uğur ÇİĞDEM BAYAZIT SağlıkPsikolojisi PsikolojiyeGiriş Elif BAYAZIT rıntanıtılması YalçınKulaç Türk Dili-II SesBilgisi YalçınKulaç öğrenm e öğren me 3: 4: 4: : : 6: 6: 7: SporveEgzersizFizyolojisiEgzersizinkardi ovaskülersistemüzerineetkisi SporveEgzersizFizyolojisiEgzersizinkardi ovaskülersistemüzerineetkisi RTEZ-PROTEZ ve YARDIMCI CİHAZLAR OrtezveProtezegirişTemelKavramlar RTEZ-PROTEZ ve YARDIMCI CİHAZLAR OrtezveProtezegirişTemelKavramlar öğren me öğren me TEMEL BİLGİ TEKNOLOJİLERİ Windows işletimsistemi, masaüstüortamın ıkullanma, Pencereelemanla rı, klasörvedosyalarl ailgiliseçme, oluşturma, taşımavb.işlemler Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Windows işletimsistemi, masaüstüortamın ıkullanma, Pencereelemanla rı, klasörvedosyalarl ailgiliseçme, oluşturma, taşımavb.işlemler Öğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİnkılapT arihi-ii Milli Mücadele Ayşe Eryaman Atatürk İlkeleriveİnkılapT arihi-ii Milli Mücadele Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Elektroterapining eneletkileri FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Elektroterapining eneletkileri FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Elektroterapinin geneletkileri FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Elektroterapinin geneletkileri FİZYOTERAPİDE KLİNİK KAVRAMLAR Fizyoterapirehabilitasyonka vramı, çeşitleri Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLAR Fizyoterapirehabilitasyonka vramı, çeşitleri Şeyma öğre nme İngilizce-II EvinBölümleri OğuzhanSön mez İngilizce-II EşyalarınKeli meöğretimi OğuzhanSön mez İngilizce-II There is/there are OğuzhanSön mez 3. Hafta 8: 9: 7/2/22 Pazartesi ö ğrenme 8/2/2 Salı 9/2/22 Çarşamba TIBBİ DÖKÜMANTASYON Tıbbidökümantasyonayönel ikgenelkavramlar 2/2/22 Perşembe öğre nme 2/2/22 Cuma ö ğrenme 22/2/22 Cumartesi ö ğrenme 9: : ö ğrenme TIBBİ DÖKÜMANTASYON Tıbbidökümantasyonayönel ikgenelkavramlar öğre nme öğ renme 26

27 : : : 2: ö ğrenme ö ğrenme TEMEL BİLGİ TEKNOLOJİLERİ Word hakkındagenelbilgiler, Word ekranelemanları Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Word hakkındagenelbilgiler, Word ekranelemanları Öğr.Gör. Uğur ÇİĞDEM SağlıkPsikolojisi Sağlık Psikolojisinin Çalışma Alanları Elif BAYAZIT SağlıkPsikolojisi SağlıkPsikolojisininÇalışmaA lanları Elif BAYAZIT Türk Dili-II CümleTürleri: Anlamınagöre cümleler YalçınKulaç Türk Dili-II CümleTürleri: Anlamınagöre cümleler YalçınKulaç öğr enme öğr enme öğ renme öğ renme 3: 4: 4: : : 6: 6: 7: ö ğrenme ö ğrenme ö ğrenme ö ğrenme SporveEgzersizFizyolojisiKardiovaskülerr egülasyonveentegrasyon SporveEgzersizFizyolojisiKardiovaskülerr egülasyonveentegrasyon RTEZ-PROTEZ ve YARDIMCI CİHAZLARÖnayakhastalıkları RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Önayakhastalıkları TEMEL BİLGİ TEKNOLOJİLERİ Word hakkındagenelbilgiler, Word ekranelemanları Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Word hakkındagenelbilgiler, Word ekranelemanları Öğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİnkıl aptarihi-ii Milli Mücadele Ayşe Eryaman Atatürk İlkeleriveİnkıl aptarihi-ii Milli Mücadele Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASY ON YÖNTEMİ II Elektroterapi çeşitleri Şeyma FİZİK TEDAVİ VE REHBİLİTASY ON YÖNTEMİ II Elektroterapi çeşitleri Şeyma FİZİK TEDAVİ VE REHBİLİTAS YON YÖNTEMİ II Elektroterap içeşitleri Şeyma FİZİK TEDAVİ VE REHBİLİTAS YON YÖNTEMİ II Elektroterap içeşitleri Şeyma FİZYOTERAP İDE KLİNİK KAVRAMLA R Egzersizçeşit leri, sınıflandırılm ası Şeyma FİZYOTERAP İDE KLİNİK KAVRAMLA R Egzersizçeşit leri, sınıflandırılm ası Şeyma ö ğrenme İngilizce-II This/that/ these ve those yapıları OğuzhanS önmez İngilizce-II This/that/t hese ve those yapıları OğuzhanS önmez İngilizce-II This/that/t hese ve those yapıları OğuzhanS önmez 4. Hafta 8 : 9 : 24/2/2 2 Pazartesi 2/2/2 Salı 26/2/22 Çarşamba TIBBİ DÖKÜMANTASYON Tıbbidokümanvedöküm antasyonuntarihçesi-i 27/2/22 Perşembe 28/2/22 Cuma 29/2/22 Cumarte si 27

28 9 : : TIBBİ DÖKÜMANTASYON Tıbbidokümanvedöküm antasyonuntarihçesi-i : : : 2 : TEMEL BİLGİ TEKNOLOJİLERİ Word ilemetinseçme, taşıma, kopyalamaişlemleri, Word ileçeşitliişlemler Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Word ilemetinseçme, taşıma, kopyalamaişlemleri, Word ileçeşitliişlemler Öğr.Gör. Uğur ÇİĞDEM SağlıkPsikolojisi Algı Elif BAYAZIT SağlıkPsikolojisi Algı Elif BAYAZIT Türk Dili-II CümleTürleri: Anlamınagörecüm leler YalçınKulaç Türk Dili-II CümleTürleri: Anlamınagörecüm leler YalçınKulaç 3 : 4 : 4 : : : 6 : 6 : 7 : SporveEgzersizFizyolojisiEgzersizin solunumsistemiüzerineetkisi SporveEgzersizFizyolojisiEgzersizin solunumsistemiüzerineetkisi RTEZ-PROTEZ ve YARDIMCI CİHAZLARKısayürümeortezleri RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Kısayürümeortezleri TEMEL BİLGİ TEKNOLOJİLERİ Word ilemetinseçme, taşıma, kopyalamaişlemleri, Word ileçeşitliişlemler Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Word ilemetinseçme, taşıma, kopyalamaişlemleri, Word ileçeşitliişlemler Öğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİnkılap Tarihi-II TürkiyeCumhuriy eti ninkuruluşu Ayşe Eryaman Atatürk İlkeleriveİnkılap Tarihi-II TürkiyeCumhuriy eti ninkuruluşu Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Ultrason FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Ultrason FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Ultrason FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Ultrason FİZYOTERAPİDE KLİNİK KAVRAMLAR Nörolojikhastalıklarda klinikkavramlaröğr. Gör. Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLAR Nörolojikhastalıklarda klinikkavramlaröğr. Gör. Şeyma İngilizce- II Can ve can t modal verb I Öğr. Gör. Oğuzha nsönme z İngilizce- II Can ve can t modal verb I Oğuzhan Sönmez İngilizce- II Can ve can t modal verb I Oğuzhan Sönmez. Hafta 8 : 9 : 2/3/2 2 Pazartes i Bağımsı zöğren me 3/3/22 Salı 4/3/22 Çarşamba TIBBİ DÖKÜMANTASYON Tıbbidokümanvedökümantasyo nuntarihçesi-ii /3/22 Perşembe öğren me 6/3/22 Cuma 7/3/2 2 Cumart esi Bağımsı zöğrenm e 28

29 9 : : : : : 2 : TEMEL BİLGİ TEKNOLOJİLERİ Excel hakkındagenelbilgiler, Hücre, satırsütunüzerindeseçme, taşıma, kopyalama vb. Hücreleribiçimlendirme, Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Excel hakkındagenelbilgiler, Hücre, satırsütunüzerindeseçme, taşıma, kopyalama vb. Hücreleribiçimlendirme, Öğr.Gör. Uğur ÇİĞDEM TIBBİ DÖKÜMANTASYONTıbbidoküm anvedökümantasyonuntarihçes i-ii SağlıkPsikolojisi Bilinç Elif BAYAZIT SağlıkPsikolojisi Bilinç Elif BAYAZIT öğren me Türk Dili-II Sözcüktürleri: isimveisimöbekl eri YalçınKulaç Türk Dili-II Sözcüktürleri: isimveisimöbekl eri YalçınKulaç Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e 3 : 4 : 4 : : : 6 : 6 : 7 : SporveEgzersizFizyolojisiEgzersizi nnöromuskülersistemüzerineetki si SporveEgzersizFizyolojisiEgzersizi nnöromuskülersistemüzerineetki si RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Uzunyürümeortezleri RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Uzunyürümeortezleri TEMEL BİLGİ TEKNOLOJİLERİ Excel hakkındagenelbilgiler, Hücre, satırsütunüzerindeseçme, taşıma, kopyalama vb. Hücreleribiçimlendirme, Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Excel hakkındagenelbilgiler, Hücre, satırsütunüzerindeseçme, taşıma, kopyalama vb. Hücreleribiçimlendirme, Öğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİnkıla ptarihi-ii CumhuriyetinD emokratikleşm esi Ayşe Eryaman Atatürk İlkeleriveİnkıla ptarihi-ii CumhuriyetinD emokratikleşm esi Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASYO N YÖNTEMİ II Ultrason Şeyma FİZİK TEDAVİ VE REHBİLİTASYO N YÖNTEMİ II Ultrason Şeyma FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Ultrason FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Ultrason FİZYOTERAPİDE KLİNİK KAVRAMLAR Nörolojikhastalıklar daklinikkavramlaröğ r. Gör. Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLAR Nörolojikhastalıklar daklinikkavramlaröğ r. Gör. Şeyma Bağımsı zöğrenm e İngilizce -II Can ve can t modal verb II Öğr. Gör. Oğuzh ansön mez İngilizce -II Can ve can t modal verb II Öğr. Gör. Oğuzha nsönme z İngilizce -II Can ve can t modal verb II Öğr. Gör. Oğuzha nsönme z 6. Hafta 9/ 3/2 2 Paza rtesi /3/22 Salı /3/22 Çarşamba 2/3/22 Perşembe 3/3/22 Cuma 4/3/2 2 Cumart esi 29

30 8 : 9 : 9 : : : : : 2 : Bağ ımsı z öğre nme Bağ ımsı z öğre nme Bağ ımsı z öğre nme Bağı msız öğre nme TEMEL BİLGİ TEKNOLOJİLERİ ExceldeHesapYapma Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ ExceldeHesapYapma Öğr.Gör. Uğur ÇİĞDEM TIBBİ DÖKÜMANTASYONTıbbidökümantasyonu nuluslararasıkullanımıvetürkiye desağlıkk ayıtları TIBBİ DÖKÜMANTASYON Tıbbidökümantasyonunuluslararasıkullanı mıvetürkiye desağlıkkayıtları SağlıkPsikolojisi ÖğrenmeveBellek Elif BAYAZIT SağlıkPsikolojisi ÖğrenmeveBellek Elif BAYAZIT öğ renme öğ renme Türk Dili-II Zamirler YalçınKulaç Türk Dili-II Zamirler YalçınKulaç Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e 3 : 4 : 4 : : : 6 : 6 : 7 : Bağı msız öğre nme Bağı msız öğre nme Bağı msız öğre nme Bağı msız öğre nme SporveEgzersizFizyolojisiİstiraha ttevefizikselaktivitedeenerjiharc aması SporveEgzersizFizyolojisiİstiraha ttevefizikselaktivitedeenerjiharc aması RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Bel kemerliuzunyürümeortezleri RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Bel kemerliuzunyürümeortezleri TEMEL BİLGİ TEKNOLOJİLERİ ExceldeHesapYapma Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ ExceldeHesapYapma Öğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİ nkılaptari hi-ii Cumhuriye tinlaikleş mesi Ayşe Eryaman Atatürk İlkeleriveİ nkılaptari hi-ii Cumhuriye tinlaikleş mesi Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTA SYON YÖNTEMİ II TENS Şeyma FİZİK TEDAVİ VE REHBİLİTA SYON YÖNTEMİ II TENS Şeyma FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II TENS FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II TENS FİZYOTERAPİDE KLİNİK KAVRAMLAR Ortopedikhastalıkla rdaklinikkavramlar FİZYOTERAPİDE KLİNİK KAVRAMLAR Ortopedikhastalıkla rdaklinikkavramlar Bağıms ızöğren me İngilizc e-ii Can ve can t modal verb III Öğr. Gör. Oğuzh ansön mez İngilizc e-ii Can ve can t modal verb III Öğr. Gör. Oğuzha nsönm ez İngilizc e-ii Can ve can t modal verb III Öğr. Gör. Oğuzha nsönm ez 3

31 7. Hafta 8 : 9 : 9 : : : : : 2 : 6/3/2 2 Pazartesi Bağımsı z Bağımsı z Bağımsı z 7/3/22 Salı TEMEL BİLGİ TEKNOLOJİLERİ Microsoft Powerpointhakkındagenelbilgiler, Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Microsoft Powerpointhakkındagenelbilgiler, Öğr.Gör. Uğur ÇİĞDEM 8/3/22 Çarşamba TIBBİ DÖKÜMANTASYONTıbbid ökümantasyonçeşitleri TIBBİ DÖKÜMANTASYON Tıbbidökümantasyonçeşitl eri SağlıkPsikolojisi KişilikVeGelişimDönemler i KendiniGerçekleştirme Elif BAYAZIT SağlıkPsikolojisi KişilikVeGelişimDönemler i KendiniGerçekleştirme Elif BAYAZIT 9/3/22 Perşembe öğr enme öğr enme Türk Dili-II Sıfatvesıfatö bekleri YalçınKulaç Türk Dili-II Sıfatvesıfatö bekleri YalçınKulaç 2/3/22 Cuma 2/3/22 Cumarte si 3 : 4 : 4 : : : 6 : 6 : 7 : SporveEgzersizFizyolojisiEgzersizinendo krinsistemüzerineetkisiveyorgunluk SporveEgzersizFizyolojisiEgzersizinendo krinsistemüzerineetkisiveyorgunluk RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Gövdeortezleri RTEZ-PROTEZ ve YARDIMCI CİHAZLARGövdeortezleri TEMEL BİLGİ TEKNOLOJİLERİ Microsoft Powerpointhakkındagenel bilgiler, Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Microsoft Powerpointhakkındagenel bilgiler, Öğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİn kılaptarihi- II Milliyetçilikİ lkesi Ayşe Eryaman Atatürk İlkeleriveİn kılaptarihi- II Milliyetçilikİ lkesi Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTAS YON YÖNTEMİ II TENS Şeyma FİZİK TEDAVİ VE REHBİLİTAS YON YÖNTEMİ II TENS ŞeymaKOR UM FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II TENS FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II TENS FİZYOTERAPİDE KLİNİK KAVRAMLAR Ortopedikhastalıklar daklinikkavramlar FİZYOTERAPİDE KLİNİK KAVRAMLAR Ortopedikhastalıklar daklinikkavramlar İngilizce- II Writing çalışmas ı Öğr. Gör. Oğuzha nsönme z İngilizce- II Writing çalışması Oğuzhan Sönmez İngilizce- II Writing çalışması Oğuzhan Sönmez 3

32 8. Hafta 8: 9: 23/3/22 Pazartesi 24/3/22 Salı 2/3/22 Çarşamba TIBBİ DÖKÜMANTASYON Tıbbidökümanlarıntaşımasıg erekenözellikler 26/3/22 Perşembe 27/3/22 Cuma öğren me 28/3/22 Cumartesi öğr enme 9: : TIBBİ DÖKÜMANTASYON Tıbbidökümanlarıntaşımasıg erekenözellikler öğren me öğr enme : : : 2: 3: 4: 4: : : 6: 6: 7: ö ğrenme ö ğrenme ö ğrenme ö ğrenme ö ğrenme TEMEL BİLGİ TEKNOLOJİLERİ Powerpointsunum Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Powerpointsunum Öğr.Gör. Uğur ÇİĞDEM Öğr.Gör. Uğur ÇİĞDEM SporveEgzersizFizyolojisiEgzersiz sonrasıtoparlanma SporveEgzersizFizyolojisiEgzersiz sonrasıtoparlanma RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Hastalıklaragöreortezuygulamala rı RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Hastalıklaragöreortezuygulamala rı TEMEL BİLGİ TEKNOLOJİLERİ Powerpointsunum Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Powerpointsunum Öğr.Gör. Uğur ÇİĞDEM Türk Dili-II Zarflar YalçınKulaç Türk Dili-II Zarflar YalçınKulaç Atatürk İlkeleriveİnkıl aptarihi-ii Devletçilikİl kesi Ayşe Eryaman Atatürk İlkeleriveİnkıl aptarihi-ii Devletçilikİl kesi Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASYO N YÖNTEMİ II Enterfaransiyel Akım Şeyma FİZİK TEDAVİ VE REHBİLİTASYO N YÖNTEMİ II Enterfaransiyel Akım Şeyma öğren me öğren me FİZİK TEDAVİ VE REHBİLİTASYO N YÖNTEMİ II Enterfaransiyel Akım Şeyma FİZİK TEDAVİ VE REHBİLİTASYO N YÖNTEMİ II Enterfaransiyel Akım Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLAR Sporveegzersizk avramları FİZYOTERAPİDE KLİNİK KAVRAMLAR Sporveegzersizk avramları öğr enme öğr enme öğr enme öğ renme İngilizce-II Reading çalışması OğuzhanS önmez İngilizce-II Reading çalışması OğuzhanS önmez İngilizce-II Reading çalışması OğuzhanS önmez 9. Hafta 8 : 9 : 3/3/2 2 Pazartes i Bağıms ızöğren me 3/3/2 Salı /4/22 Çarşamba TIBBİ DÖKÜMANTASYON Tıbbidökümanlarınkalitesininyükselt ilmesineyönelikolarakyapılançalışm alar 2/4/22 Perşembe ö ğrenme 3/4/22 Cuma 4/4/2 2 Cumart esi Bağımsı zöğrenm e 32

33 9 : : : : : 2 : Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e TEMEL BİLGİ TEKNOLOJİLERİ VeritabanıİşlemleriÖğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ VeritabanıİşlemleriÖğr.Gör. Uğur ÇİĞDEM TIBBİ DÖKÜMANTASYON Tıbbidökümanlarınkalitesininyükselt ilmesineyönelikolarakyapılançalışm alar SağlıkPsikolojisi DavranışBozuklukları Öfke- Anksiyete- Çatışma- SavunmaMekanizmaları Elif BAYAZIT SağlıkPsikolojisi DavranışBozuklukları Öfke- Anksiyete- Çatışma- SavunmaMekanizmaları Elif BAYAZIT ö ğrenme Türk Dili-II Eylemler YalçınKula ç Türk Dili-II Eylemler YalçınKula ç Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e 3 : 4 : 4 : : : 6 : 6 : 7 : Bağımsı z Bağımsı z Bağımsı z Bağımsı z SporveEgzersizFizyolojisiFiz ikseluygunluğuntanımlanm ası, kardiorespiratuaruygunluk SporveEgzersizFizyolojisiFiz ikseluygunluğuntanımlanm ası, kardiorespiratuaruygunluk RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Üstekstremiteprotezleri RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Üstekstremiteprotezleri TEMEL BİLGİ TEKNOLOJİLERİ VeritabanıİşlemleriÖğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ VeritabanıİşlemleriÖğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİ nkılaptari hi-ii İnkılâplara Tepkiler Ayşe Eryaman Atatürk İlkeleriveİ nkılaptari hi-ii İnkılâplara Tepkiler Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTA SYON YÖNTEMİ II Enterfara nsiyelakı m Şeyma FİZİK TEDAVİ VE REHBİLİTA SYON YÖNTEMİ II Enterfara nsiyelakı m ŞeymaKO RUM FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II EnterfaransiyelAkım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II EnterfaransiyelAkım FİZYOTERAPİDE KLİNİK KAVRAMLAR Fizyoterapidesıklıklakarşıla şılanhastalıklarveyaralanm alar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğ r. Gör. Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLAR Fizyoterapidesıklıklakarşıla şılanhastalıklarveyaralanm alar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğ r. Gör. Şeyma Bağıms ızöğren me İngilizc e-ii WAS /WERE, The Simple Past Tense Öğr. Gör. Oğuzh ansön mez İngilizc e-ii WAS /WERE, The Simple Past Tense Öğr. Gör. Oğuzha nsönm ez İngilizc e-ii WAS /WERE, The Simple Past Tense Öğr. Gör. Oğuzha nsönm ez 33

34 . Hafta 8 : 9 : 6/ 4/2 2 Paza rtesi Bağ ımsı z öğre nme 7/4/2 Salı 8/4/22 Çarşamba TIBBİ DÖKÜMANTASYO N Bilgi vebelgeileilgilitem elkavramlar 9/4/22 Perşembe /4/22 Cuma /4/2 2 Cumart esi Bağımsı zöğrenm e 9 : : Bağ ımsı z öğre nme TIBBİ DÖKÜMANTASYO N Bilgi vebelgeileilgilitem elkavramlar Bağımsı zöğrenm e : : : 2 : Bağ ımsı z öğre nme Bağı msız öğre nme TEMEL BİLGİ TEKNOLOJİLERİ Resimlerveçizimaraççubuğuileçalış mak Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Resimlerveçizimaraççubuğuileçalış mak Öğr.Gör. Uğur ÇİĞDEM SağlıkPsikolojisi Zaman Yönetimi Elif BAYAZIT SağlıkPsikolojisi Zaman Yönetimi Elif BAYAZIT Türk Dili-II Ekeylemler YalçınKulaç Türk Dili-II Ekeylemler YalçınKulaç Bağımsı zöğrenm e Bağımsı zöğrenm e 3 : 4 : 4 : : : 6 : 6 : Bağı msız öğre nme Bağı msız öğre nme Bağı msız öğre nme Bağı msız öğre nme SporveEgzersizFizyolojisiKardiores piratuaruygunluğundeğerlendirilm esi( Pratikuygulama ) SporveEgzersizFizyolojisiKardiores piratuaruygunluğundeğerlendirilm esi( Pratikuygulama ) RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Alt ekstremiteprotezleri RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Alt ekstremiteprotezleri TEMEL BİLGİ TEKNOLOJİLERİ Resimlerveçizimar aççubuğuileçalışm ak Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Resimlerveçizimar Atatürk İlkeleriveİnkılapT arihi-ii TürkTarihininAna yasalarıveözellikl eri Ayşe Eryaman Atatürk İlkeleriveİnkılapT arihi-ii TürkTarihininAna yasalarıveözellikl eri Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II DiadinamikAkım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II DiadinamikAkım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II DiadinamikAkım FİZYOTERAPİDE KLİNİK KAVRAMLARFizyoterapidesıklıkla karşılaşılanhastalıklarveyaralanma lar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) FİZYOTERAPİDE KLİNİK KAVRAMLARFizyoterapidesıklıkla karşılaşılanhastalıklarveyaralanma Bağımsı zöğren me İngilizce -II The Simple Past Tense Öğr. Gör. Oğuzh ansön mez İngilizce -II The Simple Past Tense Öğr. Gör. Oğuzha nsönm ez İngilizce -II The 34

35 7 : aççubuğuileçalışm ak Öğr.Gör. Uğur ÇİĞDEM DiadinamikAkım lar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) Simple Past Tense Öğr. Gör. Oğuzha nsönm ez. Hafta 8: 9: 3/4/22 Pazartesi ö ğrenme 4/4/2 Salı /4/22 Çarşamba TIBBİ DÖKÜMANTASYON Belgeyönetimiamacı-faydalarıÖğr. Gör. Mehmet 6/4/22 Perşembe öğre nme 7/4/22 Cuma 8/4/22 Cumartesi öğre nme 9: : ö ğrenme TIBBİ DÖKÜMANTASYON Belgeyönetimiamacı-faydalarıÖğr. Gör. Mehmet öğre nme öğre nme : : : 2: ö ğrenme ö ğrenme TEMEL BİLGİ TEKNOLOJİLERİ Photoshop Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Photoshop Öğr.Gör. Uğur ÇİĞDEM SağlıkPsikolojisi Pediatric- GeriatrikHastayaPs ikolojikdestek Elif BAYAZIT SağlıkPsikolojisi Pediatric- GeriatrikHastayaPs ikolojikdestek Elif BAYAZIT Türk Dili-II Eylemsiler YalçınKulaç Türk Dili-II Eylemsiler YalçınKulaç öğre nme öğre nme 3: 4: 4: : : 6: ö ğrenme ö ğrenme ö ğrenme SporveEgzersizFizyolojisiG üç,kuvvetvekassaluygunluğu ndeğerlendirilmesi ( pratikuygulama) SporveEgzersizFizyolojisiG üç,kuvvetvekassaluygunluğu ndeğerlendirilmesi ( pratikuygulama) RTEZ-PROTEZ ve YARDIMCI CİHAZLAR El protezleri TEMEL BİLGİ TEKNOLOJİLERİ Photoshop Öğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİnkı laptarihi-ii Eğitimİnkılâb ı Ayşe Eryaman Atatürk İlkeleriveİnkı laptarihi-ii Eğitimİnkılâb ı Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASY ON YÖNTEMİ II Russian Akım Şeyma FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Russian Akım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Russian Akım FİZYOTERAPİDE KLİNİK KAVRAMLAR Fizyoterapidesıklıklakarşılaşılanha stalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğr. Gör. Şeyma öğr enme İngilizce-II Düzenli/Düz ensizfiiller OğuzhanSö nmez İngilizce-II Düzenli/Düze nsizfiiller OğuzhanSön mez 3

36 6: 7: ö ğrenme RTEZ-PROTEZ ve YARDIMCI CİHAZLAR El protezleri TEMEL BİLGİ TEKNOLOJİLERİ Photoshop Öğr.Gör. Uğur ÇİĞDEM FİZİK TEDAVİ VE REHBİLİTASY ON YÖNTEMİ II Russian Akım Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLAR Fizyoterapidesıklıklakarşılaşılanha stalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğr. Gör. Şeyma İngilizce-II Düzenli/Düze nsizfiiller OğuzhanSön mez 2. Hafta 8 : 9 : 2/4/2 2 Pazartes i 2/4/2 Salı 22/4/22 Çarşamba TIBBİ DÖKÜMANTASY ON Bilgi vebelgehizmetis unankurumlar-i- II Mehmet 23/4/22 Perşembe 24/4/22 Cuma 2/4/22 Cumarte si 9 : : TIBBİ DÖKÜMANTASY ON Bilgi vebelgehizmetis unankurumlar-i- II Mehmet : : : 2 : 3 : 4 : 4 : : TEMEL BİLGİ TEKNOLOJİLERİ Ms Outlook hakkındagenelbilgiler Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Ms Outlook hakkındagenelbilgiler Öğr.Gör. Uğur ÇİĞDEM SporveEgzersizFizyolojisiGüç, kuvvetvekassalenduransileilgiliegzer sizprogramlarınınoluşturulması( pratikuygulama ) SporveEgzersizFizyolojisiGüç, kuvvetvekassalenduransileilgiliegzer sizprogramlarınınoluşturulması( pratikuygulama ) SağlıkPsikolojisi SosyalHizmete Muhtaç Hasta veyaralılarapsik olojikdestek/ KayıplardaPsiko lojikdestek Elif BAYAZIT SağlıkPsikolojisi SosyalHizmete Muhtaç Hasta veyaralılarapsik olojikdestek/ KayıplardaPsiko lojikdestek Elif BAYAZIT öğren me öğren me Türk Dili-II Edat YalçınKulaç Türk Dili-II Edat YalçınKulaç Atatürk İlkeleriveİnkılapT arihi-ii ToplumsalAlanda Yapınlaİnkılâplar Ayşe Eryaman Atatürk İlkeleriveİnkılapT arihi-ii ToplumsalAlanda Yapınlaİnkılâplar Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Russian Akım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Russian Akım Bağımsı zöğrenm e İngilizce- II Sımple past tense tıme expressi 36

37 : 6 : 6 : 7 : RTEZ-PROTEZ ve YARDIMCI CİHAZLARAyakprotezleri RTEZ-PROTEZ ve YARDIMCI CİHAZLARAyakprotezleri TEMEL BİLGİ TEKNOLOJİLERİ Ms Outlook hakkındagenelbi lgiler Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Ms Outlook hakkındagenelbi lgiler Öğr.Gör. Uğur ÇİĞDEM FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Russian Akım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Russian Akım FİZYOTERAPİDE KLİNİK KAVRAMLAR İzyoterapidesıklıklakarşılaşıla nhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğr. Gör. Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLAR İzyoterapidesıklıklakarşılaşıla nhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğr. Gör. Şeyma ons Öğr. Gör. Oğuzha nsönm ez İngilizce- II Sımple past tense tıme expressi ons Öğr. Gör. Oğuzhan Sönmez İngilizce- II Sımple past tense tıme expressi ons Öğr. Gör. Oğuzhan Sönmez 3. Hafta 8 : 9 : 27/4/2 2 Pazartes i 28/4/2 Salı 29/4/22 Çarşamba TIBBİ DÖKÜMANTASYO N Hastanelerinsınıfla ndırılması, hastanefonksiyonl arı Mehmet 3/4/22 Perşembe //22 Cuma 2//22 Cumarte si 9 : : TIBBİ DÖKÜMANTASYO N Hastanelerinsınıfla ndırılması, hastanefonksiyonl arı Mehmet : : : 2 : TEMEL BİLGİ TEKNOLOJİLERİ Internet Explorer hakkındagenelbilgiler Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Internet Explorer hakkındagenelbilgiler Öğr.Gör. Uğur ÇİĞDEM SağlıkPsikolojisi Afetlerde- TravmatikOlaylar dapsikolojikdeste k Elif BAYAZIT SağlıkPsikolojisi Afetlerde- TravmatikOlaylar dapsikolojikdeste k Türk Dili-II Bağlaç YalçınKulaç Türk Dili-II Bağlaç YalçınKulaç 37

38 ElifBAYAZIT 3 : 4 : 4 : : : 6 : 6 : 7 : SporveEgzersizFizyolojisiDirençlie ğitimprogramlarınınplanlanması,esnekliğdeğerlendirilmesiveesne klikprogramlarınınoluşturulması ( pratikuygulama) SporveEgzersizFizyolojisiDirençlie ğitimprogramlarınınplanlanması,esnekliğdeğerlendirilmesiveesne klikprogramlarınınoluşturulması ( pratikuygulama) RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Üstve Alt ekstremiteprotezleri RTEZ-PROTEZ ve YARDIMCI CİHAZLARÜstve Alt ekstremiteprotezleri TEMEL BİLGİ TEKNOLOJİLERİ Internet Explorer hakkındagenelbilgi ler Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Internet Explorer hakkındagenelbilgi ler Öğr.Gör. Uğur ÇİĞDEM Atatürk İlkeleriveİnkılapT arihi-ii TürkiyeCumhuriy eti nindışpolitikas ı Ayşe Eryaman Atatürk İlkeleriveİnkılapT arihi-ii TürkiyeCumhuriy eti nindışpolitikas ı Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Mikroakım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Mikroakım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Mikroakım FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Mikroakım FİZYOTERAPİDE KLİNİK KAVRAMLAR Fizyoterapidesıklıklakarşılaşıl anhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğr. Gör. Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLAR Fizyoterapidesıklıklakarşılaşıl anhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğr. Gör. Şeyma İngilizce- II Reading, Writtiin gçalışm ası II Öğr. Gör. Oğuzha nsönme z İngilizce- II Reading, Writtiin gçalışm ası II Öğr. Gör. Oğuzhan Sönmez İngilizce- II Reading, Writtiin gçalışm ası II Öğr. Gör. Oğuzhan Sönmez 4. Hafta 8: 9: 9: : 4//2 2 Pazart esi Bağıms ızöğren me Bağıms ızöğren me //22 Salı 6//22 Çarşamba TIBBİ DÖKÜMANTASYONSağlıkkur uluşlarındaevrakvedosyalam ahizmetleri TIBBİ DÖKÜMANTASYON Sağlıkkuruluşlarındaevrakve dosyalamahizmetleri 7//22 Perşembe öğren me öğren me 8//22 Cuma 9//2 2 Cumar tesi Bağıms ızöğren me Bağıms ızöğren me 38

39 : : : 2: 3: 4: 4: : : 6: 6: 7: Bağıms ızöğren me Bağıms ızöğren me Bağıms ızöğren me Bağıms ızöğren me Bağıms ızöğren me Bağıms ızöğren me TEMEL BİLGİ TEKNOLOJİLERİ Web tasarım Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Web tasarım Öğr.Gör. Uğur ÇİĞDEM SporveEgzersizFizyolojisiEgzersi zreçetelerininoluşturulmasıveyo rumlanması( pratikuygulama) SporveEgzersizFizyolojisiEgzersi zreçetelerininoluşturulmasıveyo rumlanması( pratikuygulama) RTEZ-PROTEZ ve YARDIMCI CİHAZLAROrtezveProtezlerinuy gulanışı RTEZ-PROTEZ ve YARDIMCI CİHAZLAROrtezveProtezlerinuy gulanışı SağlıkPsikolojisi Tükenmişlik Elif BAYAZIT SağlıkPsikolojisi Tükenmişlik Elif BAYAZIT TEMEL BİLGİ TEKNOLOJİLERİ Bilişimteknolojisi Öğr.Gör. Uğur ÇİĞDEM TEMEL BİLGİ TEKNOLOJİLERİ Bilişimteknolojisi Öğr.Gör. Uğur ÇİĞDEM Türk Dili-II Yazılıvesözlüan latımtürleri YalçınKulaç Türk Dili-II Yazılıvesözlüan latımtürleri YalçınKulaç Atatürk İlkeleriveİnkıl aptarihi-ii TürkiyeCumh uriyeti nindış Politikası Ayşe Eryaman Atatürk İlkeleriveİnkıl aptarihi-ii TürkiyeCumh uriyeti nindış Politikası Ayşe Eryaman FİZİK TEDAVİ VE REHBİLİTASY ON YÖNTEMİ II ESWT Şeyma FİZİK TEDAVİ VE REHBİLİTASY ON YÖNTEMİ II ESWT Şeyma FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Diğeryöntemler FİZİK TEDAVİ VE REHBİLİTASYON YÖNTEMİ II Diğeryöntemler FİZYOTERAPİDE KLİNİK KAVRAMLARFizyoterapidesık lıklakarşılaşılanhastalıklarvey aralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğr. Gör. Şeyma FİZYOTERAPİDE KLİNİK KAVRAMLARFizyoterapidesık lıklakarşılaşılanhastalıklarvey aralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları)öğr. Gör. Şeyma Bağıms ızöğren me Bağıms ızöğren me Bağıms ızöğren me Bağım sızöğr enme İngilizc e-ii Sımpl e prese nt tense and sımpl e past tense Öğr. Gör. Oğuz hans önme z İngilizc e-ii Sımple presen t tense and sımple past tense Öğr. Gör. Oğuzh ansön mez İngilizc e-ii Sımple presen t tense and sımple past tense Öğr. Gör. Oğuzh 39

40 ansön mez İkinci Sınıf Güz Dönemi Ders Programı (ÜÇÜNCÜ YARIYIL) 8: 9: 9: : : : : 2: 3: 4: 4: : : 6: 6: 7: Gün/Ay/Yıl Pazartesi Gün/Ay/Yıl Salı. Hafta Gün/Ay/Yıl Çarşamba Gün/Ay/Yıl Perşembe UYUM HAFTASI Gün/Ay/Yıl Cuma İkinci sınıf, üçüncü yarıyıl döneminin ilk haftası uyum haftası olarak yürütülmektedir. Uyum haftası boyunca öğrencilerin uyum süreci, aşağıdaki başlıklar veya belirlenen başka konular çerçevesinde desteklenmelidir; Öğrenci değişim programlarının tanıtımı (Erasmus, Farabi, Mevlana Değişim programları) Çift Anadal ve Yandal Eğitimine ilişkin bilgilendirme Öğrenci kulüplerine ilişkin bilgilendirme Lisansüstü eğitime ilişkin bilgilendirme Üniversite bünyesinde hizmet veren Kariyer Uygulama Ve Araştırma Merkezi hakkında bilgilendirme 2. Hafta 8 : 9 : 9 : 3/9/29 Pazartesi YaşlılardaHastalıklarve Fizyoterapi //29 Salı NörolojikHastalıklarveFiz yoterapi 2//29 Çarşamba MeslekiYabancıDil-I Dersinveyabancıdilolarakİ ngilizcenintanımı EmrahÇevik MeslekiYabancıDil-I Dersinveyabancıdilolarakİ 3//29 Perşembe 4//29 Cuma MeslekiYabancıDil-I Dersinveyabancıdilolara 4

41 : : : : 2 : Gerontoloji, GeriatriVeYaşlanmaileilgi litanımlar YaşlılardaHastalıklarve Fizyoterapi Gerontoloji, GeriatriVeYaşlanmaileilgi litanımlar YaşlılardaHastalıklarve Fizyoterapi Gerontoloji, GeriatriVeYaşlanmaileilgi litanımlar Medulla spinalis yaralanmalarınınoluşumme kanizmalarıveözellikleri NörolojikHastalıklarveFiz yoterapi Medulla spinalis yaralanmalarınınoluşumme kanizmalarıveözellikleri NörolojikHastalıklarveFiz yoterapi Medulla spinalis yaralanmalarınınoluşumme kanizmalarıveözellikleri ngilizcenintanımı EmrahÇevik kingilizcenintanımı EmrahÇevik OrtopedikHastalıklarveF izyoterapi Ortopedikrehabilitasyon agiriş OrtopedikHastalıklarveF izyoterapi Ortopedikrehabilitasyon agiriş 3 : 4 : 4 : : : 6 : 6 : 7 : KİNEZYOLOJİ Normal YürüyüşünTanımı. Normal YürüyüşünBelirleyicileri KİNEZYOLOJİ Normal YürüyüşünTanımı. Normal YürüyüşünBelirleyicileri İŞ VE UĞRAŞI Fonksiyonellıkİ çinhareketanaliziöğr. Gör. Mehmet İŞ VE UĞRAŞI Fonksiyonellıkİç inhareketanaliziöğr. Gör. Mehmet MASAJ Masajıntanımıvetarihselgel işimi MASAJ Masajıntanımıvetarihselgel işimi İLETİŞİM İletişimeDairGenelBilgiler Öğr.Gör.Mehmet DARICI İLETİŞİM İletişimeDairGenelBilgiler Öğr.Gör.Mehmet DARICI AraştırmaYöntemveTek nikleri AraştırmaveYaşlıBakımın daaraştırmanınönemi, BilimselYöntemveAşamal arı, Veri, VeriToplamadaGenelİlkel er, VerininÖzellikleri Alptekin DEVELİ AraştırmaYöntemveTek nikleri AraştırmaveYaşlıBakımın daaraştırmanınönemi, BilimselYöntemveAşamal arı, Veri, VeriToplamadaGenelİlkel er, VerininÖzellikleri Alptekin DEVELİ RomatizmalHastalı larvefizyoterapi RomatolojilRehabili tasyonagiriş,kavramlarvemulti disiplineryaklaşım RomatizmalHastalı larvefizyoterapi RomatolojilRehabili tasyonagiriş,kavramlarvemulti disiplineryaklaşım RomatizmalHastalı larvefizyoterapi RomatolojilRehabili tasyonagiriş,kavramlarvemulti disiplineryaklaşım OrtopedikHastalıklarveF izyoterapi Ortopedikrehabilitasyon agiriş KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUDersi çeriğivetanımlanması, Kardiyakrehabilitasyonu ntarihçesi, tanımıvekomponentleri. Major kalphastalıklarıtanımıveg enelözellikleri KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUDersi çeriğivetanımlanması, Kardiyakrehabilitasyonu ntarihçesi, tanımıvekomponentleri. Major kalphastalıklarıtanımıveg enelözellikleri KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUDersi çeriğivetanımlanması, Kardiyakrehabilitasyonu ntarihçesi, tanımıvekomponentleri. Major kalphastalıklarıtanımıveg enelözellikleri 4

42 3. Hafta 8: 9: 9: : : : : 2: 7//29 Pazartesi YaşlılardaHastalıklar vefizyoterapi Yaşlanmailemeydana gelenfizyolojikdeğişikl ikler YaşlılardaHastalıklar vefizyoterapi Yaşlanmailemeydana gelenfizyolojikdeğişikl ikler YaşlılardaHastalıklar vefizyoterapi Yaşlanmailemeydana gelenfizyolojikdeğişikl ikler 8//29 Salı NörolojikHastalık larvefizyoterapi Spastisiteninpato fizyolojisi, değerlendirmevei nhibisyonyöntem leri NörolojikHastalık larvefizyoterapi Spastisiteninpato fizyolojisi, değerlendirmevei nhibisyonyöntem leri NörolojikHastalık larvefizyoterapi Spastisiteninpato fizyolojisi, değerlendirmevei nhibisyonyöntem leri 9//29 Çarşamba MeslekiYabancıD il-i Olmak fiilinintümöznelere göreçekimi, tekilveçoğulkullanı mları, CümleninÖğeleri, SözcükdizimiÖğr. Gör. EmrahÇevik MeslekiYabancıD il-i Olmak fiilinintümöznelere göreçekimi, tekilveçoğulkullanı mları, CümleninÖğeleri, SözcükdizimiÖğr. Gör. EmrahÇevik //29 Perşembe //29 Cuma MeslekiYabancıDil-I Olmak fiilinintümözneleregöreçekim i, tekilveçoğulkullanımları, CümleninÖğeleri, Sözcükdizimi Emrah OrtopedikHastalıklarveFizyot erapi Ortopedikrehabilitasyonunön emiveamaçları, Ortopedikrehabilitasyondagen eldeğerlendirmevetedavi program OrtopedikHastalıklarveFizyot erapi Ortopedikrehabilitasyonunön emiveamaçları, Ortopedikrehabilitasyondagen eldeğerlendirmevetedavi program 3: 4: 4: : : KİNEZYOLOJİYürüyüş ündeğerlendirilmesi. YürüyüşünDeğerlendi rilmesi KİNEZYOLOJİYürüyüş ündeğerlendirilmesi. YürüyüşünDeğerlendi rilmesi İŞ VE UĞRAŞI GünlükYaşamAktivit elerideğerlendirilme MASAJ MasajınEtkileriÖğr. Gör. Mehmet MASAJ MasajınEtkileriÖğr. Gör. Mehmet İLETİŞİM İletişiminKullanım AlanlarıÖğr.Gör.M ehmet DARICI AraştırmaYöntem veteknikleri DeğişkenlerArasın dakiilişkilerinincel enmesi, Ölçümİşlemlerive Ölçekler, ÖlçümAraçları, ÖlçümFarklılıkları nınnedenleri Alptekin DEVELİ AraştırmaYöntem veteknikleri DeğişkenlerArasın dakiilişkilerinincel enmesi, Ölçümİşlemlerive Ölçekler, ÖlçümAraçları, ÖlçümFarklılıkları nınnedenleri Alptekin DEVELİ RomatizmalHastalılarveFizyotera piromatolojikrehabilitasyondade ğerlendirme RomatizmalHastalılarveFizyotera piromatolojikrehabilitasyondade ğerlendirme OrtopedikHastalıklarveFizyot erapi Ortopedikrehabilitasyonunön emiveamaçları, Ortopedikrehabilitasyondagen eldeğerlendirmevetedavi program KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKardiyovas külerdeğerlendirmeveelektrok ardiyografi Erkendönemkardiyakrehabilit asyonprogramı KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKardiyovas 42

43 6: 6: 7: sive Pratik Uygulamalar İŞ VE UĞRAŞI GünlükYaşamAktivitel erideğerlendirilmesiv e Pratik Uygulamalar İLETİŞİM İletişiminKullanım AlanlarıÖğr.Gör.M ehmet DARICI RomatizmalHastalılarveFizyotera piromatolojikrehabilitasyondade ğerlendirme külerdeğerlendirmeveelektrok ardiyografi Erkendönemkardiyakrehabilit asyonprogramı KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKardiyovas külerdeğerlendirmeveelektrok ardiyografi Erkendönemkardiyakrehabilit asyonprogramı 4. Hafta 8: 9: 9: : : : : 2: 4//29 Pazartesi YaşlılardaHastalıklarveFi zyoterapi Kasiskeletsistemindeyaşlanm ailemeydanagelenfizyoloji kdeğişiklikler- Projeçalışması Şeyma YaşlılardaHastalıklarveFi zyoterapi Kasiskeletsistemindeyaşlanm ailemeydanagelenfizyoloji kdeğişiklikler- Projeçalışması Şeyma YaşlılardaHastalıklarveFi zyoterapi Kasiskeletsistemindeyaşlanm ailemeydanagelenfizyoloji kdeğişiklikler- Projeçalışması Şeyma //29 Salı NörolojikHastalıklarveFiz yoterapi Tam vekısmikesilerde medulla spinalis yaralanmalarınınseviyeler egörekliniközellikleriveted aviyöntemleri NörolojikHastalıklarveFiz yoterapi Tam vekısmikesilerde medulla spinalis yaralanmalarınınseviyeler egörekliniközellikleriveted aviyöntemleri NörolojikHastalıklarveFiz yoterapi Tam vekısmikesilerde medulla spinalis yaralanmalarınınseviyeler egörekliniközellikleriveted aviyöntemleri 6//29 Çarşamba MeslekiYabancıDil-I Subject ve Object Pronouns (ÖzneveNesneZamir leri ) EmrahÇevik MeslekiYabancıDil-I Subject ve Object Pronouns (ÖzneveNesneZamirl eri ) EmrahÇevik 7//29 Perşembe 8//29 Cuma öğr enme MeslekiYaba ncıdil-i Subject ve Object Pronouns (ÖzneveNesn ezamirleri ) EmrahÇevik OrtopedikHas talıklarvefizy oterapi Kırıktedavisiv erehabilitasyo nu Şeyma OrtopedikHas talıklarvefizy oterapi Kırıktedavisiv erehabilitasyo nu Şeyma 3: 4: KİNEZYOLOJİPatolojikYürü yüş. HuduttakiYürüyüş MASAJ Masajınkullanımalanları,endikasyonlarıvekontraen dıkasyonları Mehmet AraştırmaYöntemve Teknikleri AraştırmalardaYapıl anhatalar, Yan Tutma, UygunÖrneklemeYö nteminiseçememek, YeterSayıdaDenekÜ zerindeçalışmamak, UygunÖlçüBulamam ak, AraştırmayıStandart KoşullardaYürüteme mekdoğru, OrtopedikHas talıklarvefizy oterapi Kırıktedavisiv erehabilitasyo nu Şeyma 43

44 4: : : 6: 6: 7: KİNEZYOLOJİPatolojikYürü yüş. HuduttakiYürüyüş İŞ VE UĞRAŞI HemiplejideİşUğraşıTeda visi İŞ VE UĞRAŞI HemiplejideİşUğraşıTedavi si MASAJ Masajınkullanımalanları,endikasyonlarıvekontraen dıkasyonları Mehmet İLETİŞİM İletişiminÖğeleriÖğr.Gör. Mehmet DARICI İLETİŞİM İletişiminÖğeleriÖğr.Gör. Mehmet DARICI GüvenilirveEksiksizV eritoplayamamak, UygunOlmayanİstati stikselyöntemlerkull anmak, SonuçlarıDoğruYoru mlayamamak, DiğerHataKaynakları Alptekin DEVELİ AraştırmaYöntemve Teknikleri AraştırmalardaYapıl anhatalar, Yan Tutma, UygunÖrneklemeYö nteminiseçememek, YeterSayıdaDenekÜ zerindeçalışmamak, UygunÖlçüBulamam ak, AraştırmayıStandart KoşullardaYürüteme mekdoğru, GüvenilirveEksiksizV eritoplayamamak, UygunOlmayanİstati stikselyöntemlerkull anmak, SonuçlarıDoğruYoru mlayamamak, DiğerHataKaynakları Alptekin DEVELİ RomatizmalHastalılarveFizyotera piromatolojikrehabilitasyondate daviyaklaşımları, Biyopsikososyal Model ve Hasta Eğitimi RomatizmalHastalılarveFizyotera piromatolojikrehabilitasyondate daviyaklaşımları, Biyopsikososyal Model ve Hasta Eğitimi RomatizmalHastalılarveFizyotera piromatolojikrehabilitasyondate daviyaklaşımları, Biyopsikososyal Model ve Hasta Eğitimi KARDİYO- PULMONER HASTALIKLAR REHABİLİTAS YONUDeğiştir ilebilen risk faktörlerivete davisi I- II- III Mehmet KARDİYO- PULMONER HASTALIKLAR REHABİLİTAS YONUDeğiştir ilebilen risk faktörlerivete davisi I- II- III Mehmet KARDİYO- PULMONER HASTALIKLAR REHABİLİTAS YONUDeğiştir ilebilen risk faktörlerivete davisi I- II- III Mehmet. Hafta 8 : 9 : 2//29 Pazartesi 22//29 Salı 23//29 Çarşamba MeslekiYaba ncıdil-i Possesive Adjectives (iyeliksıfatları ) 24//29 Perşembe 2//29 Cuma 44

45 9 : : : : : 2 : YaşlılardaHastalıklarveFizy oterapi Sinirsistemindeyaşlanmaile meydanagelenfizyolojikdeğiş iklikler -Projeçalışması Şeyma YaşlılardaHastalıklarveFizy oterapi Sinirsistemindeyaşlanmaile meydanagelenfizyolojikdeğiş iklikler -Projeçalışması Şeyma YaşlılardaHastalıklarveFizy oterapi Sinirsistemindeyaşlanmaile meydanagelenfizyolojikdeğiş iklikler -Projeçalışması Şeyma NörolojikHastalıklarve Fizyoterapi Normal hareketioluşturankom ponenetlerveataksinint anımı, patofizyolojisiveölçmedeğerlendirmeyönteml eri NörolojikHastalıklarve Fizyoterapi Normal hareketioluşturankom ponenetlerveataksinint anımı, patofizyolojisiveölçmedeğerlendirmeyönteml eri NörolojikHastalıklarve Fizyoterapi Normal hareketioluşturankom ponenetlerveataksinint anımı, patofizyolojisiveölçmedeğerlendirmeyönteml eri vepossesivep ronouns (sahiplikzami rleri) EmrahÇevik MeslekiYaba ncıdil-i Reflexsive Pronouns (DönüşlüZami rler) vesingular(te kil) Plural (Çoğul)Öğr. Gör. EmrahÇevik öğre nme öğre nme MeslekiYabancıDil-I Reflexsive Pronouns (DönüşlüZamirler) vesingular(tekil) Plural (Çoğul) EmrahÇevik OrtopedikHastalıklarveFizyotera pi Romatoidartrit- Osteoartritrehabilitasyonu OrtopedikHastalıklarveFizyotera pi Romatoidartrit- Osteoartritrehabilitasyonu 3 : 4 : 4 : : : 6 : KİNEZYOLOJİKemiklerinYapıs ı.kemiklerüzerineetki Eden Kuvvetler KİNEZYOLOJİKemiklerinYapıs ı.kemiklerüzerineetki Eden Kuvvetler İŞ VE UĞRAŞI Alt Motor NöronLezyonlarındaİşUğraşı Tedavisi MASAJ Masajuygulamasındage nelprensipler, vücutmekanikleri, masajekipmanları, tedaviortamı MASAJ Masajuygulamasındage nelprensipler, vücutmekanikleri, masajekipmanları, tedaviortamı İLETİŞİM KitleİletişimAraçlarıÖğr.Gör.Mehmet DARICI AraştırmaYö ntemvetekni kleri Araştırmanın Planlanması, AşamalarıveT ürleri Alptekin DEVELİ AraştırmaYö ntemvetekni kleri Araştırmanın Planlanması, AşamalarıveT ürleri Alptekin DEVELİ RomatizmalHastalılar vefizyoterapi RomatolojikRehabilita syondatedaviyaklaşı mları, AğrıYönetimivePsikolo jikdesteğinrolü RomatizmalHastalılar vefizyoterapi RomatolojikRehabilita syondatedaviyaklaşı mları, AğrıYönetimivePsikolo jikdesteğinrolü OrtopedikHastalıklarveFizyotera pi Romatoidartrit- Osteoartritrehabilitasyonu KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKardiyovaskül erhastalıklardakullanılanegzersizt estleri Egzersizeğitimivedış hasta kardiyakrehabilitasyonprogramı KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKardiyovaskül erhastalıklardakullanılanegzersizt estleri Egzersizeğitimivedış hasta kardiyakrehabilitasyonprogramı 4

46 6 : 7 : İŞ VE UĞRAŞI Alt Motor NöronLezyonlarındaİşUğraşı Tedavisi İLETİŞİM KitleİletişimAraçlarıÖğr.Gör.Mehmet DARICI RomatizmalHastalılar vefizyoterapi RomatolojikRehabilita syondatedaviyaklaşı mları, AğrıYönetimivePsikolo jikdesteğinrolü KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKardiyovaskül erhastalıklardakullanılanegzersizt estleri Egzersizeğitimivedış hasta kardiyakrehabilitasyonprogramı 6. Hafta 8 : 9 : 9 : : : : : 2 : 28//29 Pazartesi YaşlılardaHastalıklarve Fizyoterapi Kardiyopulmonersistem deyaşlanmailemeydana gelenfizyolojikdeğişiklikl er- ProjeçalışmasıÖğr. Gör. Şeyma YaşlılardaHastalıklarve Fizyoterapi Kardiyopulmonersistem deyaşlanmailemeydana gelenfizyolojikdeğişiklikl er- ProjeçalışmasıÖğr. Gör. Şeyma YaşlılardaHastalıklarve Fizyoterapi Kardiyopulmonersistem deyaşlanmailemeydana gelenfizyolojikdeğişiklikl er- ProjeçalışmasıÖğr. Gör. Şeyma 29//29 Salı NörolojikHastalıklarve Fizyoterapi Ataksitiplerineözelnör ofizyolojiktemellitedav iyöntemleriveuygulam aları NörolojikHastalıklarve Fizyoterapi Ataksitiplerineözelnör ofizyolojiktemellitedav iyöntemleriveuygulam aları NörolojikHastalıklarve Fizyoterapi Ataksitiplerineözelnör ofizyolojiktemellitedav iyöntemleriveuygulam aları 3//29 Çarşamba MeslekiYa bancıdil-i Reflexsive Pronouns (DönüşlüZa mirler) vesingular( Tekil) Plural (Çoğul)Öğr. Gör. EmrahÇevi k MeslekiYa bancıdil-i Reflexsive Pronouns (DönüşlüZa mirler) vesingular( Tekil) Plural (Çoğul)Öğr. Gör. EmrahÇevi k öğ renme öğ renme 3//29 Perşembe //29 Cuma MeslekiYabancıDil-I Reflexsive Pronouns (DönüşlüZamirler) vesingular(tekil) Plural (Çoğul) EmrahÇevik OrtopedikHastalıklarveFizyoterapi AnkilozanSpondilitveRehabilitasyonu, NonartikülerromatizmalhastalıklarveReh abilitasyonu OrtopedikHastalıklarveFizyoterapi AnkilozanSpondilitveRehabilitasyonu, NonartikülerromatizmalhastalıklarveReh abilitasyonu 3 : 4 : KİNEZYOLOJİ Kas, tendon veligamentler MASAJ Klasikmasajtekniklerive masajhareketleriöğr. Gör. Mehmet Araştırma Yöntemve Teknikleri Örneklem e, Örneklem, Örneklem Hatası, OrtopedikHastalıklarveFizyoterapi AnkilozanSpondilitveRehabilitasyonu, NonartikülerromatizmalhastalıklarveReh abilitasyonu 46

47 Örneklem Çerçevesi, Örneklem eyöntemle ri, BasitRasge leörnekle meyöntem i, TabakalıRa sgeleörne klemeyönt emi Alptekin DEVELİ 4 : : KİNEZYOLOJİ Kas, tendon veligamentler MASAJ Klasikmasajtekniklerive masajhareketleriöğr. Gör. Mehmet Araştırma Yöntemve Teknikleri Örneklem e, Örneklem, Örneklem Hatası, Örneklem Çerçevesi, Örneklem eyöntemle ri, BasitRasge leörnekle meyöntem i, TabakalıRa sgeleörne klemeyönt emi Alptekin DEVELİ RomatizmalHastalılarveFiz yoterapiromatolojikrehabi litasyondatedaviyaklaşımla rı, EklemKorumaveYorgunlukY önetimi, OrtezveYardımcıCihazlarıR olü z KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONURevaskülarizasyo nvekardiyakcerrahidensonrakardiyak rehabilitasyon.kardiyakrehabilitasyo nda hasta eğitimi : 6 : 6 : 7 : İŞ VE UĞRAŞI Transfer Aktivitelerinde Pratik Uygulama İŞ VE UĞRAŞI Transfer Aktivitelerinde Pratik UygulamaÖğr. Gör. Mehmet İLETİŞİM YeniMedyaKitleİletişi maraçlarıöğr.gör.meh met DARICI İLETİŞİM YeniMedyaKitleİletişi maraçlarıöğr.gör.meh metdarici öğ renme öğ renme RomatizmalHastalılarveFiz yoterapiromatolojikrehabi litasyondatedaviyaklaşımla rı, EklemKorumaveYorgunlukY önetimi, OrtezveYardımcıCihazlarıR olü RomatizmalHastalılarveFiz yoterapiromatolojikrehabi litasyondatedaviyaklaşımla rı, EklemKorumaveYorgunlukY önetimi, OrtezveYardımcıCihazlarıR olü KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONURevaskülarizasyo nvekardiyakcerrahidensonrakardiyak rehabilitasyon.kardiyakrehabilitasyo nda hasta eğitimi KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONURevaskülarizasyo nvekardiyakcerrahidensonrakardiyak rehabilitasyon.kardiyakrehabilitasyo nda hasta eğitimi 7. Hafta 4//29 Pazartesi //29 Salı 6//29 Çarşamba 7//29 Perşembe 8//29 Cuma 47

48 8: 9: 9: : : : : 2: YaşlılardaHastalıklarveFizyot erapi Yaşlanmaileortayaçıkanduyualgı-motor değişikliklerşeyma YaşlılardaHastalıklarveFizyot erapi Yaşlanmaileortayaçıkanduyualgı-motor değişikliklerşeyma YaşlılardaHastalıklarveFizyot erapi Yaşlanmaileortayaçıkanduyualgı-motor değişikliklerşeyma NörolojikHastalıklarveF izyoterapi Multiplsklerozunkliniköz ellikleri, ölçmedeğerlendirmeyöntemle riverehabilitasyonu NörolojikHastalıklarveF izyoterapi Multiplsklerozunkliniköz ellikleri, ölçmedeğerlendirmeyöntemle riverehabilitasyonu NörolojikHastalıklarveF izyoterapi Multiplsklerozunkliniköz ellikleri, ölçmedeğerlendirmeyöntemle riverehabilitasyonu MeslekiYabancı Dil-I İşaretZamirleri(d emonstrative pronouns) ve there is, there are kalıpları EmrahÇevik MeslekiYabancı Dil-I İşaretZamirleri(d emonstrative pronouns) ve there is, there are kalıpları EmrahÇevik MeslekiYabancıDil-I İşaretZamirleri(demonstrativ e pronouns) ve there is, there are kalıpları EmrahÇevik OrtopedikHastalıklarveFizyot erapi PFAS verehabilitasyonu OrtopedikHastalıklarveFizyot erapi PFAS verehabilitasyonu 3: 4: 4: : : 6: 6: 7: KİNEZYOLOJİEklemlerinSınıfla ması.kaldıraçsistemleri KİNEZYOLOJİEklemlerinSınıfla ması.kaldıraçsistemleri İŞ VE UĞRAŞI Transfer Aktivitelerinde Pratik Uygulama Mehmet İŞ VE UĞRAŞI Transfer Aktivitelerinde Pratik Uygulama MASAJ Uylukmasajı MASAJ Uylukmasajı İLETİŞİM Sözlüİletişim; Yazılıiletişim; GörselİletişimÖğr.Gör.M ehmet DARICI İLETİŞİM Sözlüİletişim; Yazılıiletişim; GörselİletişimÖğr.Gör.M AraştırmaYönte mveteknikleri ÖrneklemeYönte mleri (Devam) KümeÖrnekleme Yöntemi, SistematikÖrnekl emeyöntemi, ÖrneklemBüyükl üğü Alptekin DEVELİ AraştırmaYönte mveteknikleri ÖrneklemeYönte mleri (Devam) KümeÖrnekleme Yöntemi, SistematikÖrnekl emeyöntemi, ÖrneklemBüyükl üğü Alptekin DEVELİ RomatizmalHastalıl arvefizyoterapi İnflamatuarArtritler,RomatoidArtritÖğr. Gör. Şeyma RomatizmalHastalıl arvefizyoterapi İnflamatuarArtritler,RomatoidArtritÖğr. Gör. Şeyma RomatizmalHastalıl arvefizyoterapi İnflamatuarArtritler,RomatoidArtritÖğr. OrtopedikHastalıklarveFizyot erapi PFAS verehabilitasyonu KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKoruyucu kardiyakrehabilitasyon. Periferikdamarhastalıklarında rehabilitasyon KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKoruyucu kardiyakrehabilitasyon. Periferikdamarhastalıklarında rehabilitasyon KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUKoruyucu kardiyakrehabilitasyon. 48

49 ehmet DARICI Gör. Şeyma Periferikdamarhastalıklarında rehabilitasyon 8. Hafta 8: 9: 9: : : : : 2: //29 Pazartesi 2//29 Salı 3//29 Çarşamba YaşlılardaHastalıkl arvefizyoterapi Fonksiyoneldeğerle ndirmeyöntemlerive düşmeler YaşlılardaHastalıkl arvefizyoterapi Fonksiyoneldeğerle ndirmeyöntemlerive düşmeler YaşlılardaHastalıkl arvefizyoterapi Fonksiyoneldeğerle ndirmeyöntemlerive düşmeler NörolojikHastalıklarveFi zyoterapi Parkinson hastalığınınkliniközellikl eriveölçmedeğerlendirm eyöntemleri NörolojikHastalıklarveFi zyoterapi Parkinson hastalığınınkliniközellikl eriveölçmedeğerlendirm eyöntemleri NörolojikHastalıklarveFi zyoterapi Parkinson hastalığınınkliniközellikl eriveölçmedeğerlendirm eyöntemleri MeslekiYabancıDil-I Articles (a,an,the) ve Adjectives (sıfatlar) EmrahÇevik MeslekiYabancıDil-I Articles (a,an,the) ve Adjectives (sıfatlar) EmrahÇevik 4//29 Perşembe öğre nme öğre nme //29 Cuma MeslekiYabancıDil-I Articles (a,an,the) ve Adjectives (sıfatlar) EmrahÇevik OrtopedikHastalıklarveFizyoterapi ÖnÇaprazBağyaralanmalarıveÖnÇa prazönçaprazbağyaralanmalarıver ehabilitasyonu MenisküsyaralanmalarıveRehabilit asyonu OrtopedikHastalıklarveFizyoterapi ÖnÇaprazBağyaralanmalarıveÖnÇa prazönçaprazbağyaralanmalarıver ehabilitasyonu MenisküsyaralanmalarıveRehabilit asyonu 3: 4: KİNEZYOLOJİ OmuzKol-Kompleksi MASAJ Alt bacakmasajı AraştırmaYöntemveTeknik leri AnketYöntemi, SoruKağıdınınDüzenlenmes i, GörüşmeYöntemiveİlkeleri AnketUygulamaTürleriDen eyplanlaması, KlinikDeney Alptekin DEVELİ öğre nme OrtopedikHastalıklarveFizyoterapi ÖnÇaprazBağyaralanmalarıveÖnÇa prazönçaprazbağyaralanmalarıver ehabilitasyonu MenisküsyaralanmalarıveRehabilit asyonu 4: : KİNEZYOLOJİ OmuzKol-Kompleksi MASAJ Alt bacakmasajı AraştırmaYöntemveTeknik leri AnketYöntemi, SoruKağıdınınDüzenlenmes i, GörüşmeYöntemiveİlkeleri AnketUygulamaTürleriDen eyplanlaması, KlinikDeney Alptekin DEVELİ RomatizmalH astalılarvefizy oterapi SeronegatifArt ritler, AnkilozanSpon dilit, PsöriatikArtrit, ReaktifArtrit, BehçetHastalı ğı Şeyma KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUDersiçeriğiveta nımlanması, Pulmonerrehabilitasyonuntanımıv egereklikomponentler Obstrüktifakciğerhastalıklarınınpat ofizyolojisiverehabilitasyonu : İŞ VE UĞRAŞI DuyuDeğerlendirm İLETİŞİM Sözlüİletişim; RomatizmalH astalılarvefizy KARDİYO-PULMONER HASTALIKLAR 49

50 6: esi Yazılıiletişim; GörselİletişimÖğr.Gör.M ehmet DARICI oterapi SeronegatifArt ritler, AnkilozanSpon dilit, PsöriatikArtrit, ReaktifArtrit, BehçetHastalı ğı Şeyma REHABİLİTASYONUDersiçeriğiveta nımlanması, Pulmonerrehabilitasyonuntanımıv egereklikomponentler Obstrüktifakciğerhastalıklarınınpat ofizyolojisiverehabilitasyonu 6: 7: İŞ VE UĞRAŞI DuyuDeğerlendirme si İLETİŞİM Sözlüİletişim; Yazılıiletişim; GörselİletişimÖğr.Gör.M ehmet DARICI RomatizmalH astalılarvefizy oterapi SeronegatifArt ritler, AnkilozanSpon dilit, PsöriatikArtrit, ReaktifArtrit, BehçetHastalı ğı Şeyma KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUDersiçeriğiveta nımlanması, Pulmonerrehabilitasyonuntanımıv egereklikomponentler Obstrüktifakciğerhastalıklarınınpat ofizyolojisiverehabilitasyonu 9. Hafta 8: 9: 9: : : : : 2: 8//29 Pazartesi YaşlılardaHastalıklarveFizyotera pigeriatridemultidisiplinerekipçal ışmasınınönemi YaşlılardaHastalıklarveFizyotera pigeriatridemultidisiplinerekipç alışmasınınönemi YaşlılardaHastalıklarveFizyotera pi Geriatridemultidisiplinerekipçalı şmasınınönemi 9//29 Salı öğre nme NörolojikHas talıklarvefizy oterapi Parkinson hastalığındare habilitasyony öntemleri Şeyma NörolojikHas talıklarvefizy oterapi Parkinson hastalığındare habilitasyony öntemleri Şeyma NörolojikHas talıklarvefizy oterapi Parkinson hastalığındare habilitasyony 2//29 Çarşamba MeslekiYabancı Dil-I Present Continuous Tense (Şimdiki Zaman) EmrahÇevik MeslekiYabancı Dil-I Present Continuous Tense (Şimdiki Zaman) EmrahÇevik 2//29 Perşembe 22//29 Cuma MeslekiYabancıDil-I Present Continuous Tense (Şimdiki Zaman) EmrahÇevik OrtopedikHastalıklarveFizyoter api Artroplastilerve Rehabilitasyon- OrtopedikHastalıklarveFizyoter api Artroplastilerve Rehabilitasyon-

51 öntemleri Şeyma 3: 4: 4: : : 6: 6: 7: KİNEZYOLOJİ DirsekEklemi KİNEZYOLOJİ DirsekEklemi İŞ VE UĞRAŞI DuyuAlgı Motor BütünlüğüEğitimi İŞ VE UĞRAŞI DuyuAlgı Motor BütünlüğüEğitimi MASAJ Ayak- Ayakbileğimas ajı Mehmet MASAJ Ayak- Ayakbileğimas ajı Mehmet İLETİŞİM Yaratıcıİletişi mteoriveörne kleri Öğr.Gör.Meh met DARICI İLETİŞİM Yaratıcıİletişi mteoriveörne kleri Öğr.Gör.Meh met DARICI AraştırmaYönte mveteknikleri İnternetteveKita plıktakaynaktara mayöntemi, AramaMotorları ElektronikKütüp haneler, Kütüphaneler Öğr. Gör.Alptekin DEVELİ AraştırmaYönte mveteknikleri İnternetteveKita plıktakaynaktara mayöntemi, AramaMotorları ElektronikKütüp haneler, Kütüphaneler Öğr. Gör.AlptekinDEV ELİ RomatizmalHastalılarveFi zyoterapipediatrikromat olojikhastalıklar RomatizmalHastalılarveFi zyoterapipediatrikromat olojikhastalıklar RomatizmalHastalılarveFi zyoterapi PediatrikRomatolojikHast alıklar OrtopedikHastalıklarveFizyoter api Artroplastilerve Rehabilitasyon- KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONURestriktifakc iğerproblemlerininpatofizyolojis iverehabilitasyonu Pulmonerrehabilitasyondakulla nılandeğerlendirmeyöntemleri KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONURestriktifakc iğerproblemlerininpatofizyolojis iverehabilitasyonu Pulmonerrehabilitasyondakulla nılandeğerlendirmeyöntemleri KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONURestriktifakc iğerproblemlerininpatofizyolojis iverehabilitasyonu Pulmonerrehabilitasyondakulla nılandeğerlendirmeyöntemleri. Hafta 8 : 9 : 9 : : : 2//29 Pazartesi YaşlılardaHastalıkl arvefizyoterapi Yaşlılarauygunegzer sizprogramlarıöğr. Gör. Şeyma YaşlılardaHastalıkl arvefizyoterapi Yaşlılarauygunegzer sizprogramlarıöğr. 26//29 Salı NörolojikHastalıkl arvefizyoterapi Periferiknöropatiler verehabilitasyonu NörolojikHastalıkl arvefizyoterapi Periferiknöropatiler verehabilitasyonu 27//29 Çarşamba MeslekiYabancıDil-I Simple Present Tense (Geniş Zaman) EmrahÇevik MeslekiYabancıDil-I Simple Present Tense (Geniş Zaman) EmrahÇevik 28//29 Perşembe 29//29 Cuma MeslekiYabancıDil-I Simple Present Tense (Geniş Zaman)Öğr. OrtopedikHastalıklarveFizyoter api Artroplastilerve Rehabilitasyon- 2

52 : : 2 : Gör. Şeyma YaşlılardaHastalıkl arvefizyoterapi Yaşlılarauygunegzer sizprogramlarıöğr. Gör. Şeyma Şeyma NörolojikHastalıkl arvefizyoterapi Periferiknöropatiler verehabilitasyonu OrtopedikHastalıklarveFizyoter api Artroplastilerve Rehabilitasyon- 2 3 : 4 : 4 : : : 6 : 6 : 7 : KİNEZYOLOJİ El-El Bileği KİNEZYOLOJİ El-El Bileği İŞ VE UĞRAŞIKognitifReh abilitasyon İŞ VE UĞRAŞIKognitifReh abilitasyon MASAJ Üstekstremitemasaj ı MASAJ Üstekstremitemasaj ı İLETİŞİM YaratıcıİletişimTeo riveörnekleri Öğr.Gör.Mehmet DARICI İLETİŞİM YaratıcıİletişimTeo riveörnekleri Öğr.Gör.Mehmet DARICI AraştırmaYöntemveTeknikler i GözlemYöntemi, GözlemİşlemlerininPlanlanma sıgözlemtürleri, KörlemeAraştırmaYöntemleri ninepidemiyolojidekullanımı Alptekin DEVELİ AraştırmaYöntemveTeknikler i GözlemYöntemi, GözlemİşlemlerininPlanlanma sıgözlemtürleri, KörlemeAraştırmaYöntemleri ninepidemiyolojidekullanımı Alptekin DEVELİ RomatizmalHastal ılarvefizyoterapi Osteoartrit RomatizmalHastal ılarvefizyoterapi Osteoartrit RomatizmalHastal ılarvefizyoterapi Osteoartrit OrtopedikHastalıklarveFizyoter api Artroplastilerve Rehabilitasyon- 2 KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUPulmonerreh abilitasyondaegzersizeğitimi, fizikselaktivite Solunumegzersizleri, solunumeğitimi KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUPulmonerreh abilitasyondaegzersizeğitimi, fizikselaktivite Solunumegzersizleri, solunumeğitimi KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUPulmonerreh abilitasyondaegzersizeğitimi, fizikselaktivite Solunumegzersizleri, solunumeğitimi. Hafta 8 : 9 : 9 : : : : : 2/2/29 Pazartesi YaşlılardaHastalıklarveFizyoter apisağlıklıyaşlanmaveyaşamkali tesi YaşlılardaHastalıklarveFizyoter apisağlıklıyaşlanmaveyaşamkali tesi YaşlılardaHastalıklarveFizyoter apisağlıklıyaşlanmaveyaşamkali tesi 3/2/29 Salı NörolojikHastalıklarv efizyoterapi Nöromuskülerhastalı klarverehabilitasyonu NörolojikHastalıklarv efizyoterapi Nöromuskülerhastalı klarverehabilitasyonu NörolojikHastalıklarv efizyoterapi Nöromuskülerhastalı 4/2/29 Çarşamba MeslekiYabancıDil-I Comperativesve Superlatives EmrahÇevik MeslekiYabancıDil-I Comperativesve Superlatives EmrahÇevik /2/29 Perşembe 6/2/29 Cuma MeslekiYabancıDil-I Comperativesve Superlatives EmrahÇevik OrtopedikHastalıklarve Fizyoterapi Artroplastilerve Rehabilitasyon-3 OrtopedikHastalıklarve Fizyoterapi Artroplastilerve 2

53 2 : klarverehabilitasyonu Rehabilitasyon-3 3 : 4 : 4 : : : 6 : 6 : 7 : KİNEZYOLOJİ KolumnaVertebralis KİNEZYOLOJİ KolumnaVertebralis İŞ VE UĞRAŞIKognitifRehabilitasyon İŞ VE UĞRAŞIKognitifRehabilitasyon MASAJ El-el bileğimasajı MASAJ El-el bileğimasajı İLETİŞİM YaratıcıİletişimUygula maları.öğr.gör.mehm et DARICI İLETİŞİM YaratıcıİletişimUygula maları.öğr.gör.mehm et DARICI AraştırmaYöntemveTekni kleri AraştırmalardaEtikKuralla r, VerilerinAnalizeHazırlanm asıkodlamahatadenetiml eri, El ilemarjinalveçapraztablo Yapımı, TabloveGrafikYapımYönte mi Alptekin DEVELİ AraştırmaYöntemveTekni kleri AraştırmalardaEtikKuralla r, VerilerinAnalizeHazırlanm asıkodlamahatadenetiml eri, El ilemarjinalveçapraztablo Yapımı, TabloveGrafikYapımYönte mi Alptekin DEVELİ RomatizmalHast alılarvefizyotera pi Osteoporoz RomatizmalHast alılarvefizyotera pi Osteoporoz RomatizmalHast alılarvefizyotera pi Osteoporoz OrtopedikHastalıklarve Fizyoterapi Artroplastilerve Rehabilitasyon-3 KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUHav ayolutemizlemeteknikle ri-i II KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUHav ayolutemizlemeteknikle ri-i II KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUHav ayolutemizlemeteknikle ri-i II 2. Hafta 8 : 9 : 9 : : : : : 9/2/29 Pazartesi YaşlılardaHastalıklarveFizyoterapiY aşlılıktafizyoterapiyeyönelikçalışma alanları YaşlılardaHastalıklarveFizyoterapiY aşlılıktafizyoterapiyeyönelikçalışma alanları YaşlılardaHastalıklarveFizyoterapiY aşlılıktafizyoterapiyeyönelikçalışma /2/29 Salı NörolojikHastalıkl arvefizyoterapi Spina bifida and rehabilitasyonuöğr. Gör. Şeyma NörolojikHastalıkl arvefizyoterapi Spina bifida and rehabilitasyonuöğr. Gör. Şeyma NörolojikHastalıkl arvefizyoterapi /2/29 Çarşamba MeslekiYabancıDil-I So ve Such kullanımı EmrahÇevik MeslekiYabancıDil-I So ve Such kullanımı EmrahÇevik 2/2/29 Perşembe 3/2/29 Cuma MeslekiYabancıDil-I So ve Such kullanımı EmrahÇevik OrtopedikHastalıklarv efizyoterapi OmuzProblemlerindeR ehabilitasyon OrtopedikHastalıklarv efizyoterapi 3

54 2 : alanları Spina bifida and rehabilitasyonuöğr. Gör. Şeyma OmuzProblemlerindeR ehabilitasyon 3 : 4 : 4 : : : 6 : 6 : 7 : KİNEZYOLOJİ Pelvis KİNEZYOLOJİ Pelvis İŞ VE UĞRAŞIİşveUğraşıTedavisinde El Eğitimi İŞ VE UĞRAŞIİşveUğraşıTedavisinde El Eğitimi MASAJ Sırtmasajı MASAJ Sırtmasajı İLETİŞİM Okuma vedinlemepratikleri AnlamıÖğr.Gör.Meh met DARICI İLETİŞİM Okuma vedinlemepratikleri AnlamıÖğr.Gör.Meh met DARICI AraştırmaYöntemveT eknikleri VeriAnaliziiçin SPSS İstatistikPaketProgra mınıntanıtımı (Verigirişi,verilerinsınıf landırılması,grafikçizi mleri). Alptekin DEVELİ AraştırmaYöntemveT eknikleri VeriAnaliziiçin SPSS İstatistikPaketProgra mınıntanıtımı (Verigirişi,verilerinsınıf landırılması,grafikçizi mleri). Alptekin DEVELİ RomatizmalHastalıla rvefizyoterapi FibromyaljiSendrom uveyaygınağrısendro mları RomatizmalHastalıla rvefizyoterapi FibromyaljiSendrom uveyaygınağrısendro mları RomatizmalHastalıla rvefizyoterapi FibromyaljiSendrom uveyaygınağrısendro mları OrtopedikHastalıklarv efizyoterapi OmuzProblemlerindeR ehabilitasyon KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUHa vayolutemizlemetekni kleri-iii Pulmonercerrahidereh abilitasyon KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUHa vayolutemizlemetekni kleri-iii Pulmonercerrahidereh abilitasyon KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUHa vayolutemizlemetekni kleri-iii Pulmonercerrahidereh abilitasyon 3. Hafta 8: 9: 9: : : 6/2/29 Pazartesi YaşlılardaHastalık larvefizyoterapip rojesunumları YaşlılardaHastalık larvefizyoterapip 7/2/29 Salı NörolojikHast alıklarvefizyot erapi Disk hernilerivereh abilitasyonu Şeyma NörolojikHast alıklarvefizyot 8/2/29 Çarşamba MeslekiYabancıDil-I Too ve Enough kullanımı EmrahÇevik MeslekiYabancıDil-I Too ve Enough kullanımı EmrahÇevik 9/2/29 Perşembe 2/2/29 Cuma MeslekiYabancıDil-I Too ve Enough kullanımı EmrahÇevik OrtopedikHastalıklarveFizyoterapi Bandajlamayöntemler 4

55 : : 2: rojesunumları YaşlılardaHastalık larvefizyoterapip rojesunumları erapi Disk hernilerivereh abilitasyonu Şeyma NörolojikHast alıklarvefizyot erapi Disk hernilerivereh abilitasyonu Şeyma OrtopedikHastalıklarveFizyoterapi Bandajlamayöntemler 3: 4: 4: : : 6: 6: 7: KİNEZYOLOJİ DizEklemi KİNEZYOLOJİ DizEklemi İŞ VE UĞRAŞIFarklıYaşG ruplarındaişveuğr aşıtedavisi Mehmet İŞ VE UĞRAŞIFarklıYaşGr uplarındaişveuğraş ıtedavisi MASAJ Karınmasajı Mehmet MASAJ Karınmasajı Mehmet İLETİŞİM BireyselSunum PratikleriÖğr.G ör.mehmet DARICI İLETİŞİM BireyselSunum PratikleriÖğr.G ör.mehmet DARICI AraştırmaYöntemve Teknikleri SPSS programıkullanılarak verilerinistatistiksela naliziveyorumu Alptekin DEVELİ AraştırmaYöntemve Teknikleri SPSS programıkullanılarak verilerinistatistiksela naliziveyorumu Alptekin DEVELİ Romatizmal HastalılarveF izyoterapi KonnektifDo kuhastalıkları, Sistemik Lupus Eritematozus, Skleroderma, Myozitler Şeyma Romatizmal HastalılarveF izyoterapi KonnektifDo kuhastalıkları, Sistemik Lupus Eritematozus, Skleroderma, Myozitler Şeyma Romatizmal HastalılarveF izyoterapi KonnektifDo kuhastalıkları, Sistemik Lupus Eritematozus, Skleroderma, Myozitler Şeyma OrtopedikHastalıklarveFizyoterapi Bandajlamayöntemler KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUYoğunbakımdapulmonerrehabilitas yon,solunumproblemiolanneonatallerdevepediatrikha stalardafizyoterapiverehabilitasyon KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUYoğunbakımdapulmonerrehabilitas yon,solunumproblemiolanneonatallerdevepediatrikha stalardafizyoterapiverehabilitasyon KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUYoğunbakımdapulmonerrehabilitas yon,solunumproblemiolanneonatallerdevepediatrikha stalardafizyoterapiverehabilitasyon

56 4. Hafta 8 : 9 : 9 : : : : : 2 : 23/2/29 Pazartesi YaşlılardaHastalıklarveFi zyoterapiprojesunumları YaşlılardaHastalıklarveFi zyoterapiprojesunumları YaşlılardaHastalıklarveFi zyoterapiprojesunumları 24/2/29 Salı NörolojikHastalıklar vefizyoterapi SAK, kafatravmaları, spinal veintrakraniyaltümör lerverehabilitasyonu NörolojikHastalıklar vefizyoterapi SAK, kafatravmaları, spinal veintrakraniyaltümör lerverehabilitasyonu NörolojikHastalıklar vefizyoterapi SAK, kafatravmaları, spinal veintrakraniyaltümör lerverehabilitasyonu 2/2/29 Çarşamba MeslekiYabancıDil-I Quite ve Rather EmrahÇevik MeslekiYabancıDil-I Quite ve Rather EmrahÇevik 26/2/29 Perşembe 27/2/29 Cuma MeslekiYabancıDil-I SoruKelimeleri (Question Words) EmrahÇevik OrtopedikHastalıklarveFizyote rapi Geneltartışma OrtopedikHastalıklarveFizyote rapi Geneltartışma 3 : 4 : 4 : : : 6 : 6 : 7 : KİNEZYOLOJİ Ayak-AyakBileği Mehmet KİNEZYOLOJİ Ayak-AyakBileği Mehmet İŞ VE UĞRAŞI GenelTekrar İŞ VE UĞRAŞI GenelTekrar MASAJ Yüzbölgesimasajı MASAJ Yüzbölgesimasajı İLETİŞİM GrupSunumPratikleri Öğr.Gör.Mehmet DARICI İLETİŞİM GrupSunumPratikleri Öğr.Gör.Mehmet DARICI AraştırmaYöntemveTek nikleri RaporYazımYöntemleri, RaporYazımYöntemleriDi pnotvekaynakgösterimi Alptekin DEVELİ AraştırmaYöntemveTek nikleri RaporYazımYöntemleri, RaporYazımYöntemleriDi pnotvekaynakgösterimi AlptekinDEVELİ RomatizmalHasta lılarvefizyoterapi ÇeşitliDurumlar,Septikartrit, gut, sakoidoz, diabetes mellitus, vaskülitler RomatizmalHasta lılarvefizyoterapi ÇeşitliDurumlar,Septikartrit, gut, sakoidoz, diabetes mellitus, vaskülitler RomatizmalHasta lılarvefizyoterapi ÇeşitliDurumlar,Septikartrit, gut, sakoidoz, diabetes mellitus, vaskülitler OrtopedikHastalıklarveFizyote rapi Geneltartışma KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUGünlükyaşa maktiviteleriveenerjitüketimi KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUGünlükyaşa maktiviteleriveenerjitüketimi KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONUGünlükyaşa maktiviteleriveenerjitüketimi 6

57 İkinci Sınıf Bahar Dönemi Ders Programı (DÖRDÜNCÜ YARIYIL) 8: 9: 9: : : : : 2: 3: 4: 4: : : 6: 6: 7: Gün/Ay/Yıl Pazartesi Gün/Ay/Yıl Salı. Hafta Gün/Ay/Yıl Çarşamba Gün/Ay/Yıl Perşembe UYUM HAFTASI Gün/Ay/Yıl Cuma İkinci sınıf, dördüncü yarıyıl döneminin ilk haftası uyum haftası olarak yürütülmektedir. Uyum haftası boyunca öğrencilerin uyum süreci, aşağıdaki başlıklar veya belirlenen başka konular çerçevesinde desteklenmelidir; Öğrenci değişim programlarının tanıtımı (Erasmus, Farabi, Mevlana Değişim programları) Çift Anadal ve Yandal Eğitimine ilişkin bilgilendirme Öğrenci kulüplerine ilişkin bilgilendirme Lisansüstü eğitime ilişkin bilgilendirme Üniversite bünyesinde hizmet veren Kariyer Uygulama Ve Araştırma Merkezi hakkında bilgilendirme 2.Hafta 8: 9: 9: : : Gün/Ay/Yıl Pazartesi HİDROTERAPİ-BALNEOTERAPİ Genelkavramlarvetanımlamalar HİDROTERAPİ- BALNEOTERAPİHidroterapidefizyolojik kavramlar ÇOCUK HASTALIKLARI VE FİZYOTERAPİ Gün/Ay/Yıl Salı ELEKTROTERAPİGiriş, dersiniçeriğiveuygulamatekniklerihakkınd agenel Mehmet ELEKTROTERAPİGiriş, dersiniçeriğiveuygulamatekniklerihakkınd Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTAS YON Elif BAYAZIT PSİKOSOSYAL REHABİLİTAS YON Elif BAYAZIT TIBBİ DEONTOLOJİ Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMA TENS uygulamaları Öğr. Gör.Mehmet MESLEKİ UYGULAMA TENS uygulamaları Öğr. Gör.Mehmet MESLEKİ UYGULAMAT Gün/Ay/ Yıl Cuma 7

58 : : 2: BüyümeveGelişme ÇOCUK HASTALIKLARI VE FİZYOTERAPİ Mental Motor Gelişim Şeyma agenel Mehmet ELEKTROTERAPİGiriş, dersiniçeriğiveuygulamatekniklerihakkınd agenelmehmet VE ETİK Deontolojined ir? Tanımvegiriş. Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Deontolojined ir? Tanımvegiriş. Elif BAYAZIT ENS uygulamaları Öğr. Gör.Mehmet MESLEKİ UYGULAMA TENS uygulamalarıö ğr. Gör.Mehmet 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Sahiplikbildirenkelimeler (have got, has got) Emrah ÇEVİK MESLEKİ YABANCI DİL II Simple Past Tense (Geçmiş Zaman) Emrah ÇEVİK İLKYARDIM İlk ve Acil Yardımın Tanımı, Temel İlkeleri, Amacı Elif BAYAZIT İLKYARDIM İlk ve Acil Yardımın Tanımı, Temel İlkeleri, Amacı Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Sağlıksosyolojisinegiriş, temelkavramlar, bilimselbilgi, verinintoplanmasüreci, bilim, sosyalbilimvesosyolojikavramlarınıntanıtıl ması. Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Kültür, birey, sosyaletkileşim, grupveorganizasyon, sosyalkontrolbiçimleri, sosyaltabakalaşma, ekonomi, işhayatı, aileveevlilik Öğr. Elif BAYAZIT öğre nme öğre nme MESLEKİ UYGULAMA TENS uygulamalarıö ğr. Gör.Mehmet MESLEKİ UYGULAMA TENS uygulamaları Öğr. Gör.Mehmet Bağımsı z Bağımsı z 3. Hafta 8: 9: 9: : : Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİHidroterapideuygula mayöntemleriveçeşitleri HİDROTERAPİ- BALNEOTERAPİHidroterapideuygula mayöntemleriveçeşitleri ÇOCUK HASTALIKLARI VE FİZYOTERAPİ Gün/Ay/Yıl Salı ELEKTROTERAPİAlçakveOrtaFrekanslıAkımlarınÖ zelliklerivesınıflandırılması Mehmet ELEKTROTERAPİAlçakveOrtaFrekanslıAkımlarınÖ zelliklerivesınıflandırılması Gün/Ay/Yıl Çarşamba PSİKOSOSY AL REHABİLİTA SYON Öğr. Gör.Elif BAYAZIT PSİKOSOSY AL REHABİLİTA SYON Öğr. Gör.Elif BAYAZIT TIBBİ DEONTOLO Gün/Ay/Yı l Perşembe MESLEKİ UYGULAM A TENS uygulamala rı Öğr. Gör.Mehm et MESLEKİ UYGULAM A TENS uygulamala rı Öğr. Gör.Mehm et MESLEKİ UYGULA Gün/Ay/Y ıl Cuma 8

59 : : 2: SerebralPalsideDeğerlendirme ÇOCUK HASTALIKLARI VE FİZYOTERAPİ SerebralPalsideDeğerlendirme Mehmet ELEKTROTERAPİAlçakveOrtaFrekanslıAkımlarınÖ zelliklerivesınıflandırılmasımehmet Jİ VE ETİK Etikkavram veilkeler Öğr. Gör.Elif BAYAZIT TIBBİ DEONTOLO Jİ VE ETİK Etikkavram veilkeler Öğr. Gör.Elif BAYAZIT MA TENS uygulama larıöğr. Gör.Meh met ARMAĞA N MESLEKİ UYGULAM A TENS uygulamal arıöğr. Gör.Meh met ARMAĞA N ö ğrenme 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Past Continuous Tense Emrah ÇEVİK MESLEKİ YABANCI DİL II Past Continuous Tense Emrah ÇEVİK İLKYARDIM Hastanın/Yaralının Değerlendirilmesi, Koma Pozisyonu Elif BAYAZIT İLKYARDIM Hastanın/Yaralının Değerlendirilmesi, Koma Pozisyonu Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Türkiye nintoplumsalyapısıvetürkiye desağlık, eğitimsağlıkgibitemelsosyalkurumlar Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Türkiye nintoplumsalyapısıvetürkiye desağlık, eğitimsağlıkgibitemelsosyalkurumlar Öğr. Elif BAYAZIT öğ renme öğ renme MESLEKİ UYGULAM A TENS uygulamala rıöğr. Gör.Mehm et MESLEKİ UYGULAM A TENS uygulamala rı Öğr. Gör.Mehm et ö ğrenme ö ğrenme 4.Hafta 8: 9: 9: : : : : 2: Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİHidroterapideuygu lamayöntemleriveçeşitleri HİDROTERAPİ- BALNEOTERAPİHidroterapideuygu lamayöntemleriveçeşitleri ÇOCUK HASTALIKLARI VE FİZYOTERAPİ SerebralPalsiRehabilitasyonu ÇOCUK HASTALIKLARI VE FİZYOTERAPİ SerebralPalsiRehabilitasyonu Gün/Ay/Yıl Salı ELEKTROTERAPİAlçakFrekanslıAkı mlarınuygulamayöntemleri Mehmet ELEKTROTERAPİAlçakFrekanslıAkı mlarınuygulamayöntemleri Mehmet ELEKTROTERAPİAlçakFrekanslıAkı mlarınuygulamayöntemleri Mehmet Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYO N Elif BAYAZIT PSİKOSOSYAL REHABİLİTASYO N Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Mesleknedir? Mesleğimesleky apanilkeler? Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMAGalvanikakım uygulamaları Mehmet MESLEKİ UYGULAMAGalvanikakım uygulamaları Mehmet MESLEKİ UYGULAMAGalvanikakı muygulamalarıöğr. Gör.MehmetARMAĞA N MESLEKİ UYGULAMAGalvanikakı muygulamalarıöğr. Gün/Ay/ Yıl Cuma 9

60 Mesleknedir? Mesleğimesleky apanilkeler? Elif BAYAZIT Gör.Mehmet 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Regular Verbs (DüzenliFiiller) ve Irregular Verbs (DüzensizFiiller) Emrah ÇEVİK MESLEKİ YABANCI DİL II Regular Verbs (DüzenliFiiller) ve Irregular Verbs (DüzensizFiiller) Emrah ÇEVİK İLKYARDIM Yetişkinlerde Ve Çocuklarda Solunum Yolu Tıkanması Elif BAYAZIT İLKYARDIM Yetişkinlerde Ve Çocuklarda Solunum Yolu Tıkanması Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Sağlıkvehastalıkkavramları, sağlıkvehastalığıntoplumsalkuruluş u, medikalvesosyal model, toplumsalilişkiler Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Sağlıkvehastalıkkavramları, sağlıkvehastalığıntoplumsalkuruluş u, medikalvesosyal model, toplumsalilişkiler Elif BAYAZIT MESLEKİ UYGULAMAGalvanikakım uygulamalarıöğr. Gör.Mehmet MESLEKİ UYGULAMAGalvanikakım uygulamaları Mehmet.Hafta 8: 9: 9: : : : : 2: Gün/Ay/Yıl Pazartesi HİDROTERAPİ-BALNEOTERAPİ Fluidoterapi HİDROTERAPİ-BALNEOTERAPİ Fluidoterapi ÇOCUK HASTALIKLARI VE FİZYOTERAPİ PediatrikTravmatikBeyinHasar ırehabilitasyonu Şeyma ÇOCUK HASTALIKLARI VE FİZYOTERAPİ PediatrikTravmatikBeyinHasa rırehabilitasyonu Şeyma Gün/Ay/Yıl Salı ELEKTROTERAPİAlçakveOrtaFrekanslıa kımlarınuygulamayöntemleri Mehmet ELEKTROTERAPİAlçakveOrtaFrekanslıa kımlarınuygulamayöntemleri Mehmet ELEKTROTERAPİAlçakveOrtaFrekanslıa kımlarınuygulamayöntemleri Mehmet Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Sağlıkhizmetlerinde ekipçalışması, sağlıkpersonelinint oplumdakiyeri Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Sağlıkhizmetlerinde ekipçalışması, sağlıkpersonelinint oplumdakiyeri Elif BAYAZIT Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMAFaradikakım uygulamaları Mehmet MESLEKİ UYGULAMAFaradikakım uygulamaları Mehmet MESLEKİ UYGULAMAFaradikakı muygulamalarıöğr. Gör.Mehmet MESLEKİ UYGULAMAFaradikakım uygulamalarıöğr. Gör.Mehmet Gün/A y/yıl Cuma Bağım sız öğren me Bağım sız öğren me Bağım sız öğren me Bağım sız öğren me 3: 4: 4: : MESLEKİ YABANCI DİL II Present Tenses for he Future Emrah ÇEVİK MESLEKİ YABANCI DİL II Present Tenses for he Future Emrah ÇEVİK İLKYARDIM Solunum ve Dolaşımın Durması Ve Kalp Akciğer Canlandırılması (CPR) (Yetişkin)/TYD Elif BAYAZIT İLKYARDIM Solunum ve Dolaşımın Durması Ve Kalp Akciğer Canlandırılması (CPR) MESLEKİ UYGULAMAFaradikakım uygulamalarıöğr. Gör.Mehmet MESLEKİ UYGULAMAFaradikakım uygulamaları Bağım sız öğren me Bağım sız öğren 6

61 (Yetişkin)/TYD Elif BAYAZIT : SAĞLIK SOSYOLOJİSİ Sağlığaulaşmadaeşitsizlikler 6: Elif BAYAZIT 6: 7: SAĞLIK SOSYOLOJİSİ Sağlığaulaşmadaeşitsizlikler Öğr. Elif BAYAZIT Öğr. Gör.Mehmet me Bağım sız öğren me Bağım sız öğren me 6.Hafta 8: 9: 9: : : : : 2: Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİ Girdapbanyoları HİDROTERAPİ- BALNEOTERAPİ Girdapbanyoları ÇOCUK HASTALIKLARI VE FİZYOTERAPİ MiyopatiliÇocuklardaRe habilitasyon ÇOCUK HASTALIKLARI VE FİZYOTERAPİ MiyopatiliÇocuklardaRe habilitasyon Gün/Ay/Yıl Salı ELEKTROTERAPİOrtaFrekanslıakımlarınUy gulamayöntemleri Mehmet ELEKTROTERAPİOrtaFrekanslıakımlarınUy gulamayöntemleri Mehmet ELEKTROTERAPİOrtaFrekanslıakımlarınUy gulamayöntemleri Mehmet Gün/Ay/Yıl Çarşamba PSİKOSOSY AL REHABİLİTA SYON Elif BAYAZIT PSİKOSOSY AL REHABİLİTA SYON Elif BAYAZIT TIBBİ DEONTOLOJ İ VE ETİK İlkçağ, ortaçağ, yeniçağda hasta bakımı Elif BAYAZIT TIBBİ DEONTOLOJ İ VE ETİK İlkçağ, ortaçağ, yeniçağda hasta bakımı Elif BAYAZIT Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMADiadinamikakımuygu lamaları Mehmet MESLEKİ UYGULAMADiadinamikakımuygu lamaları Mehmet MESLEKİ UYGULAMADiadinamikakımuy gulamalarımehmet MESLEKİ UYGULAMADiadinamikakımuyg ulamalarımehmet Gün/Ay /Yıl Cuma Bağımsı z öğrenm e Bağımsı z öğrenm e Bağımsı z öğrenm e Bağımsı z öğrenm e 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Future Tense (Gelecek Zaman) Emrah ÇEVİK MESLEKİ YABANCI DİL II Future Tense (Gelecek Zaman) Emrah ÇEVİK İLKYARDIM Solunum ve Dolaşımın Durması Ve Kalp Akciğer Canlandırılması (CPR) (Çocuk Ve Bebek)/TYD Elif BAYAZIT İLKYARDIM Solunum ve Dolaşımın Durması Ve Kalp Akciğer Canlandırılması (CPR) (Çocuk Ve Bebek)/TYD Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Hasta rolü, sağlıkçalışanı- hasta etkileşimi, sağlıkçalışanıolarakkendinitanıma Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Hasta rolü, sağlıkçalışanı- hasta etkileşimi, sağlıkçalışanıolarakkendinitanıma Elif BAYAZIT MESLEKİ UYGULAMADiadinamikakımuygu lamaları Mehmet MESLEKİ UYGULAMADiadinamikakımuygu lamaları Mehmet Bağımsı z öğrenm e Bağımsı z öğrenm e Bağımsı z öğrenm e Bağımsı z öğrenm e 6

62 7. Hafta 8: 9: 9: : : : : 2: Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERA Pİ Girdapbanyola rı Şeyma HİDROTERAPİ- BALNEOTERA Pİ Girdapbanyola rı Şeyma ÇOCUK HASTALIKLAR I VE FİZYOTERAPİ Spina Bifida Rehabilitasyon Şeyma ÇOCUK HASTALIKLAR I VE FİZYOTERAPİ Spina Bifida Rehabilitasyo n Şeyma Gün/Ay/Yıl Salı ELEKTROTERAPİYüksekFrekanslıAkımlarınÖzellikleriveS ınıflandırılması Mehmet ELEKTROTERAPİYüksekFrekanslıAkımlarınÖzellikleriveS ınıflandırılması Mehmet ELEKTROTERAPİYüksekFrekanslıAkımlarınÖzellikleriveS ınıflandırılmasımehmet Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Ülkemizdesağlıkmeslekleri vegelişimi Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Ülkemizdesağlıkmeslekleri vegelişimi Elif BAYAZIT Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMA NMES uygulamaları Öğr. Gör.Mehmet MESLEKİ UYGULAMA NMES uygulamaları Öğr. Gör.Mehmet MESLEKİ UYGULAMA NMES uygulamaları Öğr. Gör.Mehmet MESLEKİ UYGULAMAN MES uygulamaları Öğr. Gör.Mehmet Gün/Ay/ Yıl Cuma Bağımsı z Bağımsı z Bağımsı z Bağımsı z 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Sayılabilen (Countable) vesayılamaya n (Uncountable ) İsimler Emrah ÇEVİK MESLEKİ YABANCI DİL II Some ve Any kullanımı Emrah ÇEVİK öğre nme öğre nme İLKYARDIM Kanamalar, Şok ve Şok Tedavisi Elif BAYAZIT İLKYARDIM Kanamalar, Şok ve Şok Tedavisi Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Hasta ilişkiağıve hasta- hastaneilişkisi Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Hasta ilişkiağıve hasta- hastaneilişkisi Elif BAYAZIT T MESLEKİ UYGULAMAN MES uygulamalarıö ğr. Gör.Mehmet MESLEKİ UYGULAMA NMES uygulamaları Öğr. Gör.Mehmet öğren me öğren me Bağımsı z Bağımsı z Bağımsı z Bağımsı z 62

63 8.Hafta 8: 9: 9: : : : : 2: Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİ Girdapbanyoları HİDROTERAPİ- BALNEOTERAPİ Girdapbanyoları ÇOCUK HASTALIKLARI VE FİZYOTERAPİ Spina Bifida RehabilitasyonÖğr. Gör. Şeyma ÇOCUK HASTALIKLARI VE FİZYOTERAPİ Spina Bifida RehabilitasyonÖğr. Gör. Şeyma Gün/Ay/Yıl Salı ELEKTROTERAPİYüksekFrekanslıAkımlarınUygulamaYöntemleri Mehmet ELEKTROTERAPİYüksekFrekanslıAkımlarınUygulamaYöntemleri Mehmet ELEKTROTERAPİYüksekFrekanslıAkımlarınUygulamaYöntemleri Mehmet Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Ülkemizdesağlıkmesleklerivegelişimi Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Ülkemizdesağlıkmesleklerivegelişimi Elif BAYAZIT Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMAEnterfarrensiyelakımuygulamala Mehmet MESLEKİ UYGULAMAEnterfarrensiyelakımuygulamala Mehmet MESLEKİ UYGULAMAEnterfarrensiyelakımuygulamalarıÖ Gör.Mehmet MESLEKİ UYGULAMAEnterfarrensiyelakımuygulamalarıÖ Gör.Mehmet 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Sayılabilen (Countable) vesayılamayan (Uncountable) İsimler Emrah ÇEVİK MESLEKİ YABANCI DİL II Some ve Any kullanımı Emrah ÇEVİK HİDROTERAPİ-BALNEOTERAPİ Girdapbanyoları HİDROTERAPİ-BALNEOTERAPİ Girdapbanyoları ÇOCUK HASTALIKLARI VE FİZYOTERAPİ Spina Bifida Rehabilitasyon ÇOCUK HASTALIKLARI VE FİZYOTERAPİ Spina Bifida Rehabilitasyon MESLEKİ UYGULAMAEnterfarrensiyelakımuygulamalarıÖ Gör.Mehmet MESLEKİ UYGULAMAEnterfarrensiyelakımuygulamala Mehmet MESLEKİ YABANCI DİL II Sayılabilen (Countable) vesayılamayan (Uncountable) İsimler Emrah ÇEVİK MESLEKİ YABANCI DİL II Some ve Any kullanımı Emrah ÇEVİK 9.Hafta 8: 9: Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİ Kelebekbanyoları Gün/Ay/Yıl Salı Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMA Rus akımuygulamaları Mehmet Gün/Ay/Yıl Cuma öğ renme 63

64 9: : : : : 2: HİDROTERAPİ- BALNEOTERAPİ Kelebekbanyoları ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ObstetrikPalsiRehab ilitasyonu ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ObstetrikPalsiRehab ilitasyonu ELEKTROTERAPİYüksekFrekanslıAkımların UygulamaYöntemleri Mehmet ELEKTROTERAPİYüksekFrekanslıAkımların UygulamaYöntemleri Mehmet ELEKTROTERAPİYüksekFrekanslıAkımların UygulamaYöntemleri Mehmet PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK İnsanhaklarıevrense lbildirgesi Sağlıkhakkı, hasta hakları Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK İnsanhaklarıevrense lbildirgesi Sağlıkhakkı, hasta hakları Elif BAYAZIT MESLEKİ UYGULAMA Rus akımuygulamaları Mehmet MESLEKİ UYGULAMARusakımuyg ulamalarıöğr. Gör.Mehmet MESLEKİ UYGULAMARusakımuygul amalarımehmet öğ renme öğ renme öğ renme 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II BelirsizZamirler (Indefinite Pronouns) Emrah ÇEVİK MESLEKİ YABANCI DİL II BelirsizZamirler (Indefinite Pronouns) Emrah ÇEVİK ö<ğrenme İLKYARDIM Yaralanmalarda-yanıklarda ilk yardım Elif BAYAZIT İLKYARDIM Yaralanmalarda-yanıklarda ilk yardım Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Teşhisinanlamıveözellikleri, alternatiftıbbiyönelimler Biyopsikososyaltıpmodeli, plasebove nocebo etkisi Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Teşhisinanlamıveözellikleri, alternatiftıbbiyönelimler Biyopsikososyaltıpmodeli, plasebove nocebo etkisi Elif BAYAZIT MESLEKİ UYGULAMARusakımuygul amalarımehmet MESLEKİ UYGULAMA Rus akımuygulamaları Mehmet öğ renme öğ renme öğ renme öğ renme. Hafta 8: 9: 9: : Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİ Balneoterapi HİDROTERAPİ- BALNEOTERAPİ Balneoterapi Gün/Ay/Yıl Salı ELEKTROTERAPİYüksekFrekanslıAkımla rınuygulamayöntemleri Mehmet Gün/Ay/Y ıl Çarşamba PSİKOSOS YAL REHABİLİT ASYON Öğr. Gör.Elif BAYAZIT PSİKOSOS YAL REHABİLİT ASYON Öğr. Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMAYüksekvoltajlıkesiklipalvanik akımuygulamaları Mehmet MESLEKİ UYGULAMAYüksekvoltajlıkesiklipalvanik akımuygulamaları Mehmet Gün/Ay/Y ıl Cuma ö ğrenme ö ğrenme 64

65 : : : 2: ÇOCUK HASTALIKLARI VE FİZYOTERAPİ SkolyozRehabilitas yonu ÇOCUK HASTALIKLARI VE FİZYOTERAPİ SkolyozRehabilitas yonu ELEKTROTERAPİYüksekFrekanslıAkımla rınuygulamayöntemleri Mehmet ELEKTROTERAPİYüksekFrekanslıAkımla rınuygulamayöntemleri Mehmet Gör.Elif BAYAZIT TIBBİ DEONTOL OJİ VE ETİK Geriatrivee tik Öğr. Gör.Elif BAYAZIT TIBBİ DEONTOL OJİ VE ETİK Geriatrivee tik Öğr. Gör.Elif BAYAZIT MESLEKİ UYGULAMAYüksekvoltajlıkesiklipalvan ikakımuygulamalarıöğr. Gör.Mehmet MESLEKİ UYGULAMAYüksekvoltajlıkesiklipalvani kakımuygulamalarımehmet ö ğrenme ö ğrenme 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Çoklukveazlıkbelirt enkelimeler Emrah ÇEVİK MESLEKİ YABANCI DİL II Çoklukveazlıkbelirt enkelimeler Emrah ÇEVİK İLKYARDIM HastalıklardaIlkyardım Elif BAYAZIT İLKYARDIM HastalıklardaIlkyardım Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Stres, başetme, akılsağlığı, maddebağımlılığınıntoplumsalkökenleri Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Stres, başetme, akılsağlığı, maddebağımlılığınıntoplumsalkökenleri Elif BAYAZIT ö ğrenme ö ğrenme ö ğrenme ö ğrenme MESLEKİ UYGULAMAYüksekvoltajlıkesiklipalvanik akımuygulamalarımehmet MESLEKİ UYGULAMAYüksekvoltajlıkesiklipalvanik akımuygulamaları Mehmet ö ğrenme ö ğrenme ö ğrenme ö ğrenme.hafta 8 : 9 : 9 : : : : : Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİ Balneoterapi HİDROTERAPİ- BALNEOTERAPİ Balneoterapi ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ÇocuklardaRomato lojikrehabilitasyon ÇOCUK HASTALIKLARI VE FİZYOTERAPİ Gün/Ay/Yıl Salı ELEKTROTERAPİÇeşitlihastalıklardaAlçakFrekansl ıakımlarınkullanılmasıileilgilimakaletartışmaları Mehmet ELEKTROTERAPİÇeşitlihastalıklardaAlçakFrekansl ıakımlarınkullanılmasıileilgilimakaletartışmaları Mehmet ELEKTROTERAPİÇeşitlihastalıklardaAlçakFrekansl ıakımlarınkullanılmasıileilgilimakaletartışmaları Mehmet Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK YaşlıBakımileİlgiliYasaveYön etmelikler, MeslekiGizliliğiKorumakveÖ zelyaşamasaygıgöstermek Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK YaşlıBakımileİlgiliYasaveYön etmelikler, Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMAPar ametreler Öğr. Gör.Mehmet MESLEKİ UYGULAMAPar ametreler Öğr. Gör.Mehmet MESLEKİ UYGULAMAP arametrelerö ğr. Gör.Mehmet MESLEKİ UYGULAMAPa rametreleröğr. Gün/Ay/ Yıl Cuma Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e 6

66 2 : ÇocuklardaRomato lojikrehabilitasyon MeslekiGizliliğiKorumakveÖ zelyaşamasaygıgöstermek Elif BAYAZIT Gör.Mehmet 3 : 4 : 4 : : : 6 : 6 : 7 : MESLEKİ YABANCI DİL II both, either, neither kullanımı Emrah ÇEVİK MESLEKİ YABANCI DİL II both, either, neither kullanımı Emrah ÇEVİK İLKYARDIM ToksikolojikAciller Elif BAYAZIT İLKYARDIM ToksikolojikAciller Elif BAYAZIT SAĞLIK SOSYOLOJİSİ İntiharlar, intihartürlerivetürkiye deintiharlar Elif BAYAZIT SAĞLIK SOSYOLOJİSİ İntiharlar, intihartürlerivetürkiye deintiharlar Elif BAYAZIT MESLEKİ UYGULAMAPar ametreleröğr. Gör.Mehmet MESLEKİ UYGULAMAPar ametreler Öğr. Gör.Mehmet öğren me öğren me Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e Bağımsı zöğrenm e 2. Hafta 8: 9: 9: : : : : 2: Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİ Kaplıcalarveözellikle ri HİDROTERAPİ- BALNEOTERAPİ Kaplıcalarveözellikle ri ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ÇocuklardaOrtoped ikrehabilitasyon ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ÇocuklardaOrtoped ikrehabilitasyon Gün/Ay/Yıl Salı ELEKTROTERAPİÇeşitlihastalıklardaYüksekFrekanslıakı mlarınkullanılmasıileilgilimakaletartışmaları Mehmet ELEKTROTERAPİÇeşitlihastalıklardaYüksekFrekanslıakı mlarınkullanılmasıileilgilimakaletartışmaları Mehmet ELEKTROTERAPİÇeşitlihastalıklardaYüksekFrekanslıakı mlarınkullanılmasıileilgilimakaletartışmaları Mehmet Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Sağlıkhizmetlerin deetiksorunlar, kaynaklarındağıtı mındaadalet Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Sağlıkhizmetlerin deetiksorunlar, kaynaklarındağıtı mındaadalet Elif BAYAZIT Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMAFizyoterapiuygulamaları ndadikkatedilecekhususlar Mehmet MESLEKİ UYGULAMAFizyoterapiuygulamaları ndadikkatedilecekhususlar Mehmet MESLEKİ UYGULAMAFizyoterapiuygulamal arındadikkatedilecekhususlar Mehmet MESLEKİ UYGULAMAFizyoterapiuygulamala rındadikkatedilecekhususlar Mehmet Gün/Ay/ Yıl Cuma 3: 4: 4: MESLEKİ YABANCI DİL II Present Perfect Tense Emrah ÇEVİK MESLEKİ YABANCI DİL II İLKYARDIM HayvanIsırıklarıVeBöcekSokmaları Elif BAYAZIT İLKYARDIM HayvanIsırıklarıVeBöcekSokmaları öğren me öğren me MESLEKİ UYGULAMAFizyoterapiuygulamaları ndadikkatedilecekhususlar Mehmet MESLEKİ UYGULAMAFizyoterapiuygulamaları 66

67 : : 6: 6: 7: Present Perfect Tense Emrah ÇEVİK Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Doğalafetlervesağlığaetkisi Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Doğalafetlervesağlığaetkisi Elif BAYAZIT ndadikkatedilecekhususlar Mehmet 3.Hafta 8: 9: 9: : : : : 2: Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİ Kaplıcalarveözellikleri HİDROTERAPİ- BALNEOTERAPİ Kaplıcalarveözellikleri ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ÇocuklardaTeröpatikEgzers izler ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ÇocuklardaTeröpatikEgzers izler Gün/Ay/Yıl Salı ELEKTROTERAPİVakatartışması Mehmet ELEKTROTERAPİVakatartışması Mehmet ELEKTROTERAPİVakatartışması Mehmet Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK SağlıkHizmetlerindeTıbbiKötüUygula malar, Ayrımyapmamak, ÇıkarİlişkisiKurmamak Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK SağlıkHizmetlerindeTıbbiKötüUygula malar, Ayrımyapmamak, ÇıkarİlişkisiKurmamak Elif BAYAZIT Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMAUygulamalar Mehmet MESLEKİ UYGULAMAUygulamalar Mehmet MESLEKİ UYGULAMAUygulamalar Mehmet MESLEKİ UYGULAMAUygulamalarÖ ğr. Gör.Mehmet Gün/Ay/ Yıl Cuma 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Present Perfect Continuous Tense Emrah ÇEVİK MESLEKİ YABANCI DİL II Present Perfect Continuous Tense Emrah ÇEVİK İLKYARDIM ÇevreselSorunlar Elif BAYAZIT İLKYARDIM ÇevreselSorunlar Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Cinseltutumlar, toplumsaldışlanma, çocuklar, engellileryaşlılar, kronikhastalıklarvetoplumsaltutu mlar Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Cinseltutumlar, toplumsaldışlanma, çocuklar, engellileryaşlılar, kronikhastalıklarvetoplumsaltutu mlar Elif BAYAZIT MESLEKİ UYGULAMAUygulamalarÖ ğr. Gör.Mehmet MESLEKİ UYGULAMAUygulamalar Mehmet 4. Hafta 8: 9: 9: : Gün/Ay/Yıl Pazartesi HİDROTERAPİ- BALNEOTERAPİ Kaplıcalarveözellikleri HİDROTERAPİ- BALNEOTERAPİ Kaplıcalarveözellikleri Gün/Ay/Yıl Salı ELEKTROTERAPİVakatartışması Mehmet Gün/Ay/Yıl Çarşamba PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT Gün/Ay/Yıl Perşembe MESLEKİ UYGULAMATek rar Öğr. Gör.Mehmet MESLEKİ UYGULAMATek rar Öğr. Gör.Mehmet Gün/Ay/Yıl Cuma 67

68 : : : 2: ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ÇocuklardaOrtezlerVeYardı mcıcihazlar ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ÇocuklardaOrtezlerVeYardı mcıcihazlar ELEKTROTERAPİVakatartışması Mehmet ELEKTROTERAPİVakatartışmasıÖğr. Gör.Mehmet TIBBİ DEONTOLOJİ VE ETİK Ötenaziveetik, bilimselbilgikullanmak, Organ TransplantasyonlarındaEtik, SağlıkÇalışanlarınınToplumsalYük ümlülükleri Elif BAYAZIT TIBBİ DEONTOLOJİ VE ETİK Ötenaziveetik, bilimselbilgikullanmak, Organ TransplantasyonlarındaEtik, SağlıkÇalışanlarınınToplumsalYük ümlülükleri Elif BAYAZIT MESLEKİ UYGULAMATek rar Öğr. Gör.Mehmet MESLEKİ UYGULAMATek rar Öğr. Gör.Mehmet öğr enme öğr enme 3: 4: 4: : : 6: 6: 7: MESLEKİ YABANCI DİL II Past Perfect Tense ve Past Perfect Continuous Tense Emrah ÇEVİK MESLEKİ YABANCI DİL II Past Perfect Tense ve Past Perfect Continuous Tense Emrah ÇEVİK İLKYARDIM Hasta veyaralıtaşımateknikleri Elif BAYAZIT İLKYARDIM Hasta veyaralıtaşımateknikleri Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Türkiye devedünyadasağlıksistemlerivesa ğlıkpolitikaları Elif BAYAZIT SAĞLIK SOSYOLOJİSİ Türkiye devedünyadasağlıksistemlerivesa ğlıkpolitikaları Elif BAYAZIT MESLEKİ UYGULAMAT ekrar Öğr. Gör.Mehmet MESLEKİ UYGULAMAT ekrar Öğr. Gör.Mehmet öğre nme öğre nme öğr enme öğr enme öğr enme öğr enme TERAPİ VE REHABİLİTASYON BÖLÜMÜ FİZYOTERAPİ PROGRAMI DERS PLANLARI.SINIF GÜZ DÖNEMİ DERS PLANLARI TÜRK DİLİ I Öğretim Üyesi Oda Numarası E-posta Yalçın KULAÇ MA-K-9 Ders Zamanı Derslik Dersin Amacı Uzaktan Eğitim Türk Dili dersleri; yükseköğretim seviyesindeki öğrencilere kendilerini doğru ve etkili biçimde ifade etmelerinde, dil kurallarının farkında olarak Türkçeyi bilinçli ve güzel kullanmalarında katkı sağlamayı amaçlamaktadır. 68

69 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Konu ve ilgili kazanım 39 7 D D94.. Oryantasyon Haftası 39 7 D D94.2. Dersin amacı ve kaynakları. Dil kavramı ve Türkçenin Dünya Dilleri Arasındaki Yeri 39 7 D D94.2. Türk Dili I dersinde okutulacak kaynakları ve bu derse yardımcı olarak faydalanabileceği kitapları bilir D D Dil kavramı hakkında farklı tanımlar üzerinden bilgi sahibi olur D D Dil tanımların arasındaki benzer ve farklı yönler üzerinde değerlendirmeler yapar D D Dilin özelliklerini öğrenir D D94.2. İletişimde dilin önemini fark eder D D Dille iletişimin diğer iletişim şekillerinden farklı yönlerini bilir D D Dünyadaki mevcut diller hakkında genel bilgiler öğrenir D D Türkçenin dünya dilleri arasındaki yeri hakkında bilgi sahibi olur D D94.3. Yapı ve Köken Bakımından Diller 39 7 D D Dünyadaki dil grupları hakkında bilgi sahibi olur D94 3 Köken bakımından dillerin nasıl sınıflandırıldığını ve dil 39.7.D94.3. ailelerinin oluşumunu öğrenir D D94.3. Türkçenin hangi dil ailesine mensup olduğunu açıklayabilir D D Dillerin yapı bakımından özellikleri bilir D94 3 Türkçenin yapı bakımında hangi özelliklere sahip olduğunu D kavrar D D94.4. Dil-Kültür İlişkisi, Dilin Toplum Hayatındaki Yeri 39 7 D D Dil ve aile ilişkisini fark eder D D94.4. Dil ve toplum ilişkisini fark eder D D Kültür kavramı hakkında bilgi sahibi olur D D Dilin kültürle olan ilişkisini öğrenir D D Dilin toplum hayatı açısından önemini fark eder D D94.. Noktalama İşaretleri 39 7 D94 Noktalama İşaretlerinin doğru kullanımına dikkat ve özen D94..9 gösterir D94 Metinler üzerinde var olan noktalama işareti hatalarını fark D94..2 eder D94 Noktalama işaretlerini doğru kullanmanın yazılı iletişimdeki D94..2 önemini kavrar D D94.6. Yazım Kuralları 39 7 D D Yazım kurallarına ilişkin bilgilerini pekiştirir D D Ek ve bağlaçların yazımına dikkat eder D94 6 Metin yazımında büyük küçük harf kullanımına ve sayıların D yazılışına dikkat eder D D Kelimelerdeki ünlü ve ünsüz uyumu kurallarına uyar D D Kelimelerin birleşik veya ayrı yazılış özelliklerini bilir D D94.7. Sözcükte ve Cümlede Anlam 39 7 D D Kelime ve anlam ilişkisini bilir D94 7 Kelimelerin gerçek anlam, yan anlam ve mecaz anlam D özelliklerini bilir D94 7 Kelimeler arasındaki anlam farkları ve benzerliklerine dikkat D D D eder. Kelimelerin metin içerisinde başka anlamlar kazanabileceğinin farkında olur D D Cümleleri anlamlarına göre sınıflandırabilir D D Birbiriyle yakın anlamlı olan cümleleri veya çelişen cümleleri 69

70 metin içerisinde fark edebilir D94 7 Açık ve anlaşılır cümleler kurmanın yazılı anlatımdaki önemini D kavrar D D94.8. Anlatım Teknikleri 39 7 D D Anlatım tekniklerini bilir D D Doğru anlatım tekniklerini kullanmanın önemini kavrar D94 8 Yazılı anlatımda uygun anlatım yollarını kullanarak daha etkili D bir iletişim sağlayacağının farkında olur D D94.9. Resmi Yazışmalar 39 7 D94 9 Dilekçe, tutanak, kara ve rapor gibi resmi nitelikli yazışma D türleri hakkında bilgiler edinir D94 9 Dilekçe, tutanak, karar ve rapor gibi yazışma türlerini D yazmasını öğrenir D D Dilekçe yazımında dikkat edilecek hususları bilir D94 9 Dilekçe, tutanak ve rapor gibi yazışma türleri arasındaki D farkları bilir D D94.. Resmi Yazışmalar 39 7 D D94..4 İş mektupları ve öz geçmiş gibi yazışma türleri hakkında bilgiler edinir D D94..4 İş mektupları ve öz geçmiş yazımında dikkat edilecek kuralları 2 öğrenir D D94..4 Resmi kurumlarla yapılacak yazışmaları nasıl hazırlaması 3 gerektiğini kavrar D D94.. Cümlede Yardımcı Ögeler 39 7 D D Cümlenin ögeleri hakkında bilgi sahibi olur D D D D D D D D94.2. Cümlede Temel Ögeler 39 7 D D Belirtili nesne, belirtisiz nesne, dolaylı tümleç, zarf tümleci gibi cümlenin yardımcı ögelerini cümle içerisinde fark eder. Nesnelerin cümle içerisindeki türünü ve kullanılış biçimlerini açıklar. Cümle çözümlemelerinde dolaylı tümleç ve zarf tümleçleri gibi yardımcı ögeleri bulur. Bu ögelerin cümledeki işlevlerini bilir. Cümlenin yapısı ve temel ögeleri hakkında bilgi sahibi olur D D Cümlenin hangi unsurlardan oluştuğunu açıklayabilir D D94.2. Yüklemin özelliklerini bilir. Cümle içerisinde hangi kelime ve kelime gruplarının yüklem olabileceğini fark eder D D94.2. Cümledeki özneyi ve öznenin özelliklerini bilir. Hangi kelime ve kelime gruplarının özne olabileceğini kavrar D D94.2. Cümleyi oluşturan unsurların ve bunların birbirleriyle olan 2 ilişkilerinin farkında olur D D94.3. Dil Yanlışlıkları, Sözcük Düzeyinde Dil Yanlışları 39 7 D D94.3. Gereksiz kelimelerin ve eş anlamlı sözcüklerin kullanımından 3 kaynaklanan anlatım bozukluklarını fark eder D D94.3. Yanlış anlamda veya yanlış yerde kullanılan kelimelerin sebep 4 oldukları anlatım bozukluklarını kavrar D D D D Hafta-Tarih Ders Konuları Sıklıkla karıştırılan kelimelerin kullanımına dikkat eder. Yapıları bozuk olan ve dil kurallarına uymayan kelimeleri kullanmamaya özen gösterir. İlgili Program Yeterliği Eylül 29 Uyum Haftası 2 Dersin amacı ve kaynakları. Dil kavramı ve Türkçenin Dünya PY4 EKİM29 Dilleri Arasındaki Yeri 3 8 Ekim 29 Yapı ve Köken Bakımından Diller PY4 7

71 4 Ekim 29 Dil-Kültür İlişkisi, Dilin Toplum Hayatındaki Yeri PY4 22 Ekim 29 Noktalama İşaretleri PY4 6 2 Kasım 29 Yazım Kuralları PY4 7 Kasım 29 Sözcükte ve Cümlede Anlam PY4 9-7 Kasım 29 Ara sınav Kasım 29 Anlatım Teknikleri PY Kasım 29 Resmi Yazışmalar PY4 3 Aralık 29 Resmi Yazışmalar PY4 Aralık 29 Cümlede Yardımcı Ögeler PY4 2 7 Aralık 29 Cümlede Temel Ögeler PY Aralık 29 Dil Yanlışlıkları, Sözcük Düzeyinde Dil Yanlışları PY4 4 3 Aralık 29 Dil Yanlışlıkları, Cümle Düzeyinde Dil Yanlışları PY4 4-2 Ocak 22 Dönem sonu sınavı 2-26 Ocak 22 Bütünleme sınavı Bu dersin değerlendirmesi çoktan seçmeli bir ara sınav ve bir dönem sonu sınavı Değerlendirme aracılığıyla yapılacaktır. Ara sınavın ortalamaya katkısı % 4 dönem sonu sınavının ise % 6 tır. Geçme notu üzerinden 6 tır.. Aşağıdakilerden hangisi Türkçenin özelliklerinden biri değildir? A) Ünlü uyumları vardır. B) Soru eki vardır. C) Sıfatlar isimlerden önce gelir. D) Kelimeler bükümlenerek türetilir. E) Çokluk eki vardır. 2. Aşağıdaki cümlelerin hangisinde virgülün kullanım amacı diğerlerinden farklıdır? A) Kimsenin arzusu, kaprisi beni bağlamaz. B) Romanları, öyküleri, üslubu açısından çekiciydi. C) Gazeteleri, dergileri buraya istiyorum. D) Dost, kötü günde belli olur. E) Fotokopilerimiz, ders notlarımız nerede? Örnek Sorular 3. Hayatta güç olan üç şey vardır ( ) Bir sırrı saklamak ( ) bir yarayı unutmak ( ) boş zamanı kullanmak ( ) Yukarıda parantezlerle belirtilen yerlere aşağıdakilerden hangisinde verilen noktalama işaretleri getirilmelidir? A) (:) (,) (,) (.) B) (:) (;) (,) ( ) C) (;) (,) (,) (.) D) (.) (,) (,) (.) E) (.) (;) (;) ( ) 4. Aşağıdaki cümlelerin hangisinde bir yazım yanlışı yapılmıştır? A) Ben de bir şey diyeceksin sanmıştım. B) Buradan ayrılmayı hiç te düşünmedim doğrusu. C) Gitme de akşam yemek yiyelim. D) Bu kalabalığın işi bitecek de ben de göreceğim! E) Yazının karalamalarında da böyle bir şey yok.. Aşağıdaki cümlelerin hangisinde bir yazım yanlışı yapılmıştır? A) TDK'nin, Türk Dilini Geliştirme Toplantısı dün yapıldı. B) İkinci günün sonunda O'zer lira kazanmıştık. C) Son romanını da 98e yayımlamıştı. D) THY'de yeni uçak alımı tartışmaları da sona erdi. E) O krizde 2'nci kattaki dairemizi de satmak durumunda kaldık. Cevap Anahtarı.D 2.D 3. A 4.B.B 7

72 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi Prof. Dr. Hanifi Vural, Türk Dili, Taşhan Kitap, Tokat, 22..Prof. Dr. Muharrem Ergin, Türk Dil Bilgisi, Bayrak Yayınları, İstanbul, Prof. Dr. Tahsin Banguoğlu, Türkçenin Grameri, TDK Yayınları, Ankara, Prof. Dr. Mustafa Özkan vd.; Yükseköğretimde Türk Dili Yazılı ve Sözlü Anlatım, Filiz Kitabevi, İstanbul, Prof. Dr. Mehmet Kaplan, Dil ve Kültür, Dergâh Yayınları, İstanbul, 2.. Ertem, Rekin - İsa Kocakaplan, Üniversitelerde Türk Dili ve Kompozisyon 6. Serdar Odacı vd., Üniversiteler için Dil ve Anlatım, Palet Yay., Konya, Türkçe Sözlük, TDK Yayınları, Ankara, Yazım Kılavuzu, TDK Yayınları, Ankara, 22. ATATÜRK İLKELERİ VE İNKILAP TARİHİ I Öğretim Üyesi Dr. Ayşe ERYAMAN Oda Numarası 2 E-posta Ders Zamanı Perşembe 8.-. Derslik Dersin Amacı Uzaktan Eğitim Türkiye Cumhuriyeti devletinin kuruluş şartlarının ve özelliklerinin anlaşılabilmesi için; Türk milletini Kurtuluş Savaşı yapmak durumunda bırakan şartlarla, Kurtuluş Savaşının hangi şartlarda ve hangi ilkeler çerçevesinde gerçekleştiğini ve devletin hangi esaslar üzerine kurulduğunu kavratmak; böylece devletin kuruluş felsefesini bilen, devletinin ve milletinin temel değerlerine saygılı bireyler yetiştirmek. Konu ve ilgili kazanım 39 7 D D6.. Dersin amacı ve kaynakları, Atatürk İlkeleri ve İnkılap Dersiyle İlgili Temel Kavramlar ve İnkılâpçılık İlkesi 39.7.D6.. Atatürk İlkeleri ve İnkılâp Tarihi-I dersinde, Türk İnkılabının 39 7 D6 oluş nedenlerini, nasıl geliştiğini ve dayandığı ilkelerin anlatılacağını ve tanıtılacağını kavrar D D6..2 Atatürk İlkeleri ve İnkılâp Tarihi-I dersinde başvurulacak 2 kaynakların neler olduğunu bilir D D6..3 İnkılâp kavramının ne anlama geldiğini kavrar D D6..4 Devrim kavramının ne anlama geldiğini bilir D D6.. İhtilal kavramını tanımlayabilir D D6..6 Evrim/Tekâmül kavramlarının ne anlama geldiğini kavrar D D6..7 Islahat/Reform kavramlarının ne anlama geldiğini bilir D D6..8 İsyan kavramının ne anlama geldiğini bilir D D6..9 Darbe kavramını tanımlayabilir D D6.. İnkılap hareketlerinin aşamaları hakkında fikir sahibi olur D D6.. Türk İnkılabının gelişim safhaları ve özelliklerini açıklayabilir D D6..2 Atatürk İnkılaplarının oluşmasında ortaya çıkan belirleyici 2 etkenleri açıklayabilir. 72

73 39 7 D D6..3 Cumhuriyet in altı temel ilkesinden biri olan inkılapçılık 3 ilkesinin önemini, özelliklerini ve gerekliliğini kavrar D D6.2. Osmanlıların Gerilemesinin İç Sebepleri D6.2.4 Osmanlı Devleti nin gerilemesinin en önemli sebeplerinden biri 39 7 D6 4 olan devlet yönetiminde meydan gelen problemlerin neler olduğunu bilir D D6.2. Bu problemlerin devletin gerilemesine nasıl ve ne düzeyde etki ettiğini açıklayabilir D D6.2.6 Osmanlı Devleti nin toprak düzenini ve bu toprak düzeni 6 üzerine temellendirilen ekonomik sistemi kavrar D6.2.7 Ekonomik sistemde meydana gelen bozulmaların, devletin 39 7 D6 7 gerilemesi üzerine etkilerini analitik bir şekilde değerlendirebilir D D6.2.8 Osmanlı Devleti nin eğitim sisteminin özelliklerini ve sistemin 8 nasıl işlediğini bilir D6.2.9 Eğitim sistemindeki bozulmaların ne tür problemlere yol 39 7 D6 9 açtığını ve devletin gerilemesi üzerindeki önemli etkilerini açıklayabilir D D6.3. Osmanlıların Gerilemesinin Dış Sebepleri 39 7 D D6.3.2 Osmanlı Devleti nin gerilemesine neden olan sömürgeciliğin ne 2 zaman ortaya çıktığını ve nasıl geliştiğini bilir D6.3.2 Sanayi Devrimi nin nasıl ve hangi koşullarda ortaya çıktığını, 39 7 D6 2 Osmanlı Devleti nin gerilemesine nasıl etki ettiğini açıklayabilir D Emperyalizm kavramının ne anlama geldiğini ve Batılı 39 7 D6 22 devletlerin Osmanlı Devleti üzerindeki emellerinin neler olduğunu bilir D Şark Meselesi nin ne anlama geldiğini açıklayabilir ve Batılı 39 7 D6 23 devletlerin Osmanlı Devleti ni paylaşma projelerini bu kavram ışığında analitik olarak değerlendirebilir D D6.4. Çağdaş Dünyanın Temel Kavramları D Aydınlanma felsefesinin nasıl ortaya çıktığını, özelliklerini, 39 7 D6 24 Rönesans ve Reform hareketlerinin aydınlanma çağı üzerindeki etkilerini değerlendirebilir D6.4.2 Kaynağını Fransız İhtilali nden alan, demokrasi, laiklik, 39 7 D6 2 milliyetçilik, liberalizm ve sosyalizm kavramlarının sözlük anlamlarını tanımlayabilir D Bu kavramların 789 da gerçekleşen Fransız İhtilali nden sonra 39 7 D6 26 Fransız Milli Meclisi tarafından yayınlanan İnsan ve Vatandaş Hakları Demeci nde ne şekilde yer aldığını kavrar D D6.. Osmanlı Devleti nde Yenileşme Hareketleri 39 7 D D6..27 Lale Devri nde (78 den sonra) gerçekleştirilen yenileşme 27 hareketlerini açıklayabilir D D6..28 III. Selim zamanında yapılan yenilikleri açıklayabilir D D6..29 II. Mahmut döneminde gerçekleştirilen yenileşme hareketlerini 29 açıklayabilir D D6.6. Osmanlı Devleti nde Yenileşme Hareketleri 39 7 D D6.6.3 Tanzimat ve Islahat Fermanlarının ne zaman, hangi koşullarda 3 ve neden yayınlandığını bilir D D6.6.3 Tanzimat ve Islahat Fermanlarının kapsamını ve önemini 3 kavrar D D Tanzimat ve Islahat Fermanlarını müteakip, hangi alanlarda 32 ıslahatlar yapıldığını açıklayabilir D D Bu fermanlarla ulaşılmak istenen hedeflere neden 33 ulaşılamadığını açıklayabilir D Yeni Osmanlılar hareketinin nasıl ortaya çıktığını, bu hareketin 39 7 D6 34 başlıca temsilcilerini ve Osmanlı politik hayatına yaptıkları katkıları bilir D D6.6.3 Osmanlı Devleti nin ilk anayasası olan Kanun-ı Esasi nin hangi 73

74 şartlarda kabul edildiğini ve I. Meşrutiyet döneminde yaşanan siyasi gelişmeleri açıklayabilir D D I. Meşrutiyet döneminin nasıl ve ne zaman sona erdiğini bilir ARA SINAV 39 7 D D6.7. Osmanlı Devleti nin Son Döneminde Fikir Akımları 39 7 D D II. Abdülhamid döneminin siyasi atmosferi, bu dönemde 39 7 D D yaşanan iç ve dış politik gelişmeleri açıklayabilir. II. Abdülhamid döneminde Panislâmizm akımının hangi şartlarda ortaya çıktığını ve bu fikir akımından nasıl yararlanıldığını kavrar D D II. Abdülhamid döneminde gerçekleştirilen ıslahatları 39 açıklayabilir D D6.7.4 Genç Türkler ve İttihat Terakki hareketinin nasıl ortaya 4 çıktığını bilir D6.7.4 İttihat Terakki Cemiyeti nin benimsediği Osmanlıcılık siyasi 39 7 D6 4 akımının kapsamını ve hangi koşullarda ortaya çıktığını açıklayabilir D D II. Meşrutiyet in ilanından sonra benimsenmeye başlayan 42 Türkçülük fikir akımını ve özelliklerini açıklayabilir D D Batıcılık fikir akımını ve özellikleri bilir D D6.8. Osmanlı Devleti nin Yıkılışı 39 7 D D Trablusgarp Savaşı nın ne zaman ve nasıl başladığını, savaşın 44 sonuçlarının neler olduğunu açıklayabilir D6.8.4 Birinci ve İkinci Balkan Savaşlarının hangi tarihlerde ve ne 39 7 D6 4 şekilde cereyan ettiğini bilir; sonuçlarının neler olduğunu kavrar D D Birinci Dünya Savaşı nın çıkış sebeplerini açıklayabilir D D D D Birinci Dünya Savaşı öncesinde Osmanlı Devleti nin ittifak 47 arayışlarını, savaşa nasıl ve hangi blokta girdiğini bilir D Birinci Dünya Savaşı nın hangi cephelerde cereyan ettiğini ve 48 bu cephelerde yaşanan gelişmeleri kavrar D Kafkas Cephesiyle bağlantılı olarak Ermeni meselesinin nasıl ortaya çıktığını, devletin neden tehcir (zorunlu göç) kararı 49 aldığını ve zorunlu göçün hangi koşullarda gerçekleştirildiğini açıklayabilir D D6.9. Osmanlı Devleti nin Yıkılışı 39 7 D D6.9. Birinci Dünya Savaşı nın ne zaman ve nasıl sona erdiğini bilir D D6.9. Savaş sonunda imzalanan antlaşmaları bilir D D D D6.9.2 Savaş sonunda Osmanlı Devleti ile imzalanan Mondros 2 Mütarekesi nin kapsamını ve önemini açıklayabilir D6.9.3 Mondros Mütarekesi nin nasıl uygulandığını ve İtilaf 3 Devletlerinin Osmanlı Devleti nin hangi bölgelerini işgal ettiğini bilir D6.9.4 Mütareke sonrası Rumların, Ermenilerin ve Yahudilerin 4 ülkedeki bölücü faaliyetlerini ve kurdukları örgütleri kavrar D D6.. Milli Mücadele 39 7 D6 çarelerini açıklayabilir D6 6 değerlendirebilir D6 7 kurulduğunu açıklayabilir D D6.. Mondros Mütarekesi ni müteakip başlayan işgallerin ortadan kaldırılması ve ülkenin kurtarılması için düşünülen kurtuluş 39.7.D6..6 Kurtuluş çarelerinden biri olarak düşünülen barışçı ve mandacı görüşü savunanların dayanaklarının neler olduğunu 39.7.D6..7 Bölgesel kurutuluş mücadelesini savunanlarca kurulan Milli Cemiyetlerin hangileri olduğunu, nerelerde ve hangi amaçlarla 39.7.D6..8 Kuva-yıMilliye nin (Milli Kuvvetler) hangi koşullarda teşekkül ettiğini ve özelliklerini açıklayabilir D D6.. Milli Mücadele 74

75 39 7 D D6..9 Mustafa Kemal Paşa nın Anadolu ya hangi amaçla 9 gönderildiğini ve Samsun daki ilk faaliyetlerini kavrar D6..6 Kongreler aracılığıyla örgütlenme döneminin başlangıcında 39 7 D6 6 yayınlanan Havza Genelgesi, Amasya Tamiminin kapsamını ve önemini açıklayabilir D D6..6 Erzurum ve Sivas Kongrelerinin kararlarını ve önemini 6 açıklayabilir D D6.2. Milli Mücadele 39 7 D D Son Osmanlı Mebusan Meclisinin hangi tarihte toplandığını ve 62 mecliste cereyan eden olayları bilir D Son Osmanlı Mebusan Meclisi tarafından kabul edilen Misak-ı 39 7 D6 63 Milli nin nasıl hazırlandığını, hangi hususları içerdiğini ve Türk tarihi için önemini açıklayabilir D D Misak-ı Millinin kabulünden sonra ortaya çıkan tepkileri ve 64 İstanbul un neden işgal edildiğini kavrar D D6.3. Milli Mücadele 39 7 D D6.3.6 Birinci Büyük Millet Meclisinin ne zaman ve hangi koşullarda 6 açıldığını bilir D D Birinci Büyük Millet Meclisinin aldığı ilk kararları ve bu 66 kararların önemi kavrar D D Birinci Büyük Millet Meclisinin özelliklerini açıklayabilir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği Eylül 29 Uyum Haftası 2 Dersin amacı ve kaynakları 3 Ekim 29 Dersle ilgili temel kavramlar inkılâpçılık ilkesi. inkılâp, ihtilal, devrim, evrim/tekâmül, ıslahat/reform, isyan, darbe, Atatürk ün İnkılâpçılık İlkesi ve Türk İnkılâbının özellikleri 3 Osmanlıların gerilemesinin iç sebepleri. Devlet yönetiminde, Ekim 29 eğitimde, ekonomide ve genel ahlakta meydana gelen problemler 4 Osmanlıların gerilemesinin dış sebepleri. Sömürgecilik, Sanayi 7 Ekim 29 Devrimi ve emperyalizm, Batılı devletlerin Osmanlı Devleti üzerindeki emelleri, Şark Meselesi, Osmanlı Devleti ni paylaşma projeleri Çağdaş dünyanın temel kavramları: Aydınlanma, demokrasi, laiklik, 24 Ekim 29 milliyetçilik, liberalizm, sosyalizm. 6 Osmanlı devletinde yenileşme hareketleri: Lale Devri, III. Selim ve 3 Ekim 29 II. Mahmut Yenilikleri. 7 Osmanlı devletinde yenileşme hareketleri: Tanzimat ve Islahat 7 Kasım 29 Dönemi yenilikleri, Yeni Osmanlılar, Meşrutiyet hareketleri. 9-7 Kasım 29 Ara sınav 8 2 Kasım 29 Osmanlı devletinin son dönemindeki fikir akımları: Batıcılık, 9 28 Kasım 29 Osmanlıcılık, İslamcılık, Türkçülük. Osmanlı devletinin yıkılışı Trablusgarp ve Balkan Harpleri, I. Dünya Savaşı, Ermeni meselesi. Aralık 29 Osmanlı devletinin yıkılışı: I. Dünya Savaşının Sonu, Mondros Ateşkes Anlaşması, Mondros sonrası işgaller, bölücü faaliyetler. 2 Aralık 29 Millî Mücadele: Kurtuluş çareleri, barışçı ve mandacı görüş, bölgesel kurtuluş Mücadelesi, Millî Dernekler, Kuva-yı Milliye. 2 9 Aralık 29 Milli Mücadele: Atatürk ün Anadolu ya Çıkışı, kongreler yoluyla örgütlenme ve Millî Mücadelenin birleştirilmesi 3 26 Aralık 29 Millî Mücadele: Mebusan Meclisi, Misak-ı Milli ve İstanbul un resmen işgali. 4 2 Ocak 22 Millî Mücadele: TBMM nin açılışı ve Anadolu nun yönetimini ele alması, TBMM nin özellikleri. 4-2 Ocak 22 Dönem sonu sınavı 7

76 2-26 Ocak 22 Bütünleme sınavı Bu dersin değerlendirmesi, kaynak kitap temel alınarak hazırlanacak olan çoktan Değerlendirme seçmeli bir ara sınav ve bir dönem sonu sınavı aracılığıyla yapılacaktır. Ara sınavın ortalamaya katkısı % 4 dönem sonu sınavının ise % 6 tır. Geçme notu üzerinden 6 tır. - Batılı devletler Osmanlı İmparatorluğu nun iç işlerine karışmak için aşağıdakilerden hangisini dayanak olarak kullanmışlardır? a- Sened-i İttifak ı b- Veraset Sistemini c- Tımar Sistemini d- Devşirme Kanunu nu e- Azınlık haklarını 2- İlk posta teşkilatı hangi padişah döneminde oluşturulmuştur? a- III. Selim b- II. Mahmud c- II Abdülhamid d- I. Ahmet e- Abdülmecit 3- Aşağıdakilerden hangisi Osmanlı Devleti nin ilk anayasasıdır? a- 98 Anayasası b- 876 Anayasası (Kanun-u Esasi) Örnek Sorular c- 92 Anayasası d- 922 Anayasası e- 86 Anayasası 4- Hâkimiyetin kayıtsız şartsız millette olduğu bir yönetim biçimi. dir. Yukarıdaki boşluğa aşağıdaki kavramlardan hangisi gelmelidir? a- Devletçilik b- Sömürgecilik c- Demokrasi d- Liberalizm e- Sosyalizm - II. Abdülhamit döneminde devlet politikası haline getirilen, devletin dağılmasını ve hilafetin nüfuzunu kullanarak dünya siyasetinde güç kazanmanın temel alındığı fikir akımı aşağıdakilerden hangisidir? a- Panislamizm b-osmanlıcılık c- Pantürkizm d-turancılık e- Batıcılık Cevap Anahtarı -e 2-b 3-b 4-c -a Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi Sabri Zengin, Atatürk İlkeleri ve İnkılap Tarihi, Taşhan Kitap, Tokat 26. Sorumlu Olunan Sayfalar: Kitabın başından 4. sayfaya kadar. - Kemal Atatürk, Nutuk I-III, İstanbul YÖK-Komisyon, Atatürk İlkeleri ve İnkılâp Tarihi, Ankara Komisyon, Türkiye Cumhuriyeti Tarihi I-II, AAM, yay., Ankara 22. Öğretim Üyesi D4 İNGİLİZCE I Öğr.Gör.Oğuzhan SÖNMEZ Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Bu ders sonucu öğrenciler İngilizcenin temelyapılarınıkullanarakkendileriniifadeedebileceklerdir. Bu dersöğrencilereingilizcetemelyapılarınıbaşlangıçdüzeyde (Beginner / A) vermeyiamaçlar. 76

77 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Konu ve ilgili kazanım 39 D D4.. Verbto be, subjectpronouns 39 D D4.. Kişi zamirlerini öğrenir ve öznelere göre to be fiilini yerleştirebilir 39 D D4..2 Kişi zamirlerini kullanarak basit isim cümleleri kurabilir. 39 D D4..3 Günlük diyalog örnekleri verilerek sınıf içi aktivite olanağı sağlanır. 39 D D4.2. Possessiveadjectives, objectpronouns, familymembers 39 D D4.2.4 Aitlik zamiri ve aile üyelerini kavrar. 39 D D4.2. Kendi aile üyelerini tanıtabilir. 39 D D4.3. Numbers, DaysandMonths 39 D D D D4.4. Countries Sayıları öğrendiğinde yaşını ifade edebilir. Günleri ve ayları öğrendiğinde kurabildiği cümle çeşitliliğini artırır. 39 D D4.4.7 Ülkelerin öğrenimi ile beraber Yes/No sorusu ile sınıf içi çalışma yapar. 39 D D4.4.8 Ülkeleri içeren metni okuyup cevaplandırabilir. 39 D D4.. Prepositions 39 D D4..9 Günlük ihtiyacı olan nesnelerin İngilizcesini öğrenir ve 39 D D4.. kullanır. Nesnelerin konumunu anlatabilmek için yer edatlarını kullanır. 39 D D4.. Yer edatları ile sınıf içi soru- cevap çalışmaları yapar. 39 D D4.6. A / An &PluralNouns 39 D D4.6.2 Tekil nesnelerin kullanımında a / an farklılığını öğrenir. 39 D D4.6.3 Birden fazla nesne ifade ederken kelime çoğul yapabilir. 39 D D4.7. The Simple Present Tense I ( I / you / we / they) 39 D D D D D D4.7.6 Geniş zamanda I, you, we ve they özneleri ile olumlu cümle yapabilir. Fiil öğrenimini genişleterek daha fazla fiilde cümle kullanmayı deneyimler. Özneleri kullanarak negatif ve yes/ no soru cümleleri oluşturur. 39 D D4.8. Wh- questions 39 D D4.8.7 What, Where, When, How gibi soru kelimelerini öğrenir. 39 D D4.9. Present Simple Tense II 39 D D4.9.8 Geniş zamanda üçüncğ tekil şahıs özneleri ile olumlu cümle yapabilir. 39 D D4.9.9 Özneleri kullanarak negatif ve soru cümleleri oluşturur. 39 D D4.. Daily Activities Günlük aktivitelerle ilgili gerekli kelime öğretiminden sonra 39 D D4..2 kendisi ile ilgili cümle kurar. 39 D D4..2 Boş zaman aktivitelerini içeren bir metin yazabilir. 39 D D4.. Jobsandrelatedverbs 39 D D4..22 Meslekleri ve ilişkili fiilleri öğrenir. 39 D D4..23 Meslekleri içeren metni okuyup metne ait soruları cevaplayabilir. 39 D D4.2. Adjectives 39 D D Sıfatları öğrenerek daha uzun cümle kurabilir. 39 D D4.3. Parts of the body &Havegot / Has got 39 D D4.3.2 Vücudunun bölümlerini öğrenir. 39 D D Havegot ve has got yapısını kullanarak kendini anlatır. 39 D D Günlük diyalog çalışması yapabilir. 39 D D Activitieswith ing&like + Verbing 77

78 39 D D Boş zaman aktivitelerini doğru cümle kalıpları ile ifade eder. 39 D D4.4.3 Yapmayı sevdiği aktiviteleri ifade ederken fiile ing eklemeyi öğrenir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği Eylül 29 Uyum Haftası - 2 EKİM 29 verbto be, subjectpronouns PY4 3 2 Ekim 29 Possessiveadjectives, objectpronouns, familymembers PY4 4 9 Ekim 29 Numbers, DaysandMonths PY4 26 Ekim 29 Countries PY4 6 2 Kasım 29 Prepositions PY4 7 9 Kasım 29 A / An &PluralNouns PY4 9-7 Kasım 29 Ara Sınav Kasım 29 The Simple Present Tense I ( I / you / we / they) PY4 9 3 Kasım 29 Wh- questions PY4 7 Aralık 29 Present Simple Tense II PY4 4 Aralık 29 Daily Activities PY4 2 2 Aralık 29 Jobsandrelatedverbs PY Aralık 29 Adjectives PY4 4 4 Ocak 22 Parts of the body &Havegot / Has got PY4 4-2 Ocak 22 Final Sınavı 2-26 Ocak 22 Bütünleme Sınavı Değerlendirme Budersindeğerlendirmesi,derskaynaklarıilederslerde verilen bilgileresas alınarakhazırlanacakolançoktanseçmelibirvizevebirdefinal sınavı aracılığıyla yapılacaktır.vize sınavının nihai ortalamayakatkısı %4 iken, final sınavınınki %6 olacaktır.dersi geçmek için gereken nihai ortalama, final notunun en az olması kaydıyla, üzerinden6 tır. Dersten başarısız olan öğrenciler, final sınavı ile aynı etkiye sahip olan bütünleme sınavına girebilirler.. A: Areyou.? B: No. I m married. Which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? A )single B )new C )one D )different E )first Örnek Sorular 2. Let smeet at theswimming...which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? A ) park B )stadium C ) mal D )place E )pool 3. There sno sun at thebeachtoday but it is very.which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? A )warm B )cold C )cool D )cloudy E )rainy 4. A: What.. thesedays? B: I m exercising a lot. Which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? A ) do you do 78

79 Okul Program Ders Konu Kazanım Kodu B ) am I doing C )youaredoing D )areyoudoing E )arewedoing. A: How much.. jeans? B: $9.99. Which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? A )arethis B ) is that C ) is this D ) is these E )arethose Cevap Anahtarı -)a, 2-) e, 3-) a 4-) d -) e Kaynak Kitap -)EssentialGrammer in Use, Raymond Murphy, 98, Cambridge Yayınları )Advanced Grammar in Use, Raymond Murphy, 98, Cambridge Yayınları Yardımcı Kaynaklar ve Okuma Listesi ÖğretimÜyesi FTP - ANATOMİ Şeyma Oda Numarası E-posta DersZamanı Derslik DersinAmacı Öğrencilerininsanvücudunuoluşturanhücre, doku, organ vesistemlerin işlevlerihakkındabilgi, becerivesonrakidönemlerdegöreceğiderslere alt yapıkazanmalarınısağlamak. Konuveilgilikazanım 39 7 FTP 39.7.FTP.. AnatomiyeGiriş. Terminoloji. Eksen-DüzlemBilgisi 39 7 FTP 39.7.FTP.. Anatomiileilgilitemelterimvekavramlarıaçıklar FTP FTP..2 Vücudunkontrolsistemlerinibilir FTP FTP..3 Eksen-Düzlembilgisinesahipolur FTP FTP.2. HareketSistemi, ÜstEkstremiteKemikveEklemleri 39 7 FTP FTP.2.4 Kemikyapıyıaçıklar FTP FTP.2. El kemikleriniaçıklar FTP FTP.2.6 Kolkemikleriniaçıklar FTP FTP.2.7 Başvegövdekemikleriniaçıklar. 79

80 39 7 FTP FTP.2.8 Üstekstremiteeklemleriniaçıklar FTP FTP.3. HareketSistemi, Alt EkstremiteKemikveEklemleri 39 7 FTP FTP.3.9 AyakveBacakkemikleriniaçıklar FTP FTP.3. Alt ekstremitekemikleriniaçıklar FTP FTP.3. Alt ekstremiteeklemleriaçıklar FTP FTP.4. HareketSistemi, Skeleton Axiale, Eklemleri, BaşveGövdeKasları 39 7 FTP FTP.4.2 Başkaslarınıaçıklar FTP FTP.4.3 Gövdekaslarınıaçıklar FTP FTP.4.4 Başvegövdekaslarınıaçıklar FTP 39.7.FTP.. HareketSistemi, Alt veüstekstremitekasları 39 7 FTP 39.7.FTP.. Alt ekstremitekaslarınıaçıklar FTP FTP..6 Üstekstremitekaslarınıaçıklar FTP FTP.6. SolunumSistemiAnatomisi 39 7 FTP FTP.6.7 Solunumsistemianatomisiniaçıklar FTP FTP.6.8 Akciğerlerinyapıveişlevleriniaçıklar FTP FTP.6.9 Solunumyollarınınyapıveişlevleriniaçıklar FTP FTP.7. SindirimSistemiAnatomisi 39 7 FTP FTP.7.2 Sindirimsistemianatomisiniaçıklar FTP FTP.7.2 Sindirimkanalıorganlarınınanatomisi, yapıveişlevleriniaçıklar FTP FTP.7.22 Sindirimeyardımcı organ vebezlerinanatomisi, yapıveişlevleriniaçıklar FTP FTP.8. Uro- Genital SistemAnatomisi 39 7 FTP FTP.8.23 Böbreklerinyapıveişlevleriniaçıklar FTP FTP.8.24 Üreter, mesane, üretranınyapıveişlevleriniaçıklar FTP FTP.8.2 Erkeküremeorganlarınınanatomisiniaçıklar FTP FTP.8.26 Kadınüremeorganlarınınanatomisiniaçıklar FTP FTP.8.27 Üremesistemianatomisiniaçıklar FTP FTP.9. KalpveDolaşımSistemiAnatomisi 39 7 FTP FTP.9.28 Kalbinanatomisi, yapısıveişlevleriniaçıklar FTP FTP.9.29 Damarlarınyapıveişlevleriniaçıklar FTP FTP.9.3 Dolaşımçeşitleriniveözellikleriniaçıklar FTP 39.7.FTP.. MerkeziSinirSistemiAnatomisi 39 7 FTP FTP..3 Merkezîsinirsistemininyapıveişlevleriniaçıklar FTP FTP..32 Merkezisinirsistemindeyeralanyapıların (serebralkorteks, serebellum, beyinsapı, hipotalamus, thalamus, limbic sistem, bazal ganglia, ortabeyin) anatomissinikavrar FTP 39.7.FTP.. PeriferikSinirSistemiAnatomisi 39 7 FTP FTP..33 Periferiksinirsistemininyapıveişlevleriniaçıklar FTP FTP.2. OtonomSinirSistemiAnatomisi 39 7 FTP FTP.2.34 Otonomsinirsistemininyapıveişlevleriniaçıklar FTP FTP.3. DuyuOrganlarıAnatomisi 39 7 FTP FTP.3.3 Görmeorganınyapıveişlevleriniaçıklar FTP FTP.3.36 Koku organınınyapıveişlevleriniaçıklar FTP FTP.3.37 Dokunmaorganınınyapıveişlevleriniaçıklar FTP FTP.4. DuyuOrganlarıAnatomisi Hafta-Tarih DersKonuları İlgili Program Yeterliği Eylül 29 UyumHaftası 2 3 Ekim 29 HareketSistemi, ÜstEkstremiteKemikveEklemleri PY3-PY6 3 Ekim 29 HareketSistemi, Alt EkstremiteKemikveEklemleri PY3-PY6 4 7 Ekim 29 HareketSistemi, Skeleton Axiale, Eklemleri, BaşveGövdeKasları PY3-PY6 24 Ekim 29 HareketSistemi, Alt veüstekstremitekasları PY3-PY6 6 3 Ekim 29 SolunumSistemiAnatomisi PY3-PY6 7 7 Kasım 29 SindirimSistemiAnatomisi PY3-PY6 9-7 Kasım 29 Ara Sınav 8

81 8 2 Kasım 29 Uro- Genital SistemAnatomisi PY3-PY Kasım 29 KalpveDolaşımSistemiAnatomisi PY3-PY6 Aralık 29 MerkeziSinirSistemiAnatomisi PY3-PY6 2 Aralık 29 PeriferikSinirSistemiAnatomisi PY3-PY6 2 9 Aralık 29 OtonomSinirSistemiAnatomisi PY3-PY Aralık 29 DuyuOrganlarıAnatomisi PY3-PY6 4 2 Ocak 22 DuyuOrganlarıAnatomisi PY3-PY6 4-2 Ocak 22 DönemSonuSınavı 2-26 Ocak 22 BütünlemeSınavı Bu dersindeğerlendirmesi, Değerlendirme kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır. ÖrnekSorular. Aşağıdakilerdenhangisi, önkoliskeletininiçyanındayeralankemiktir? A) Os Ulna B) Os radius C) Os fibula D) OsHumerus E) Os tibia 2. Aşağıdakilerdenhangisi, kafakemiklerindendeğildir? A) Os sphenoidale B) Os vomer C) Osfrontale D) Osethmoidale E) Osparietale 3. Lumbalvertebralarsayısı, aşağıdakilerdenhangisidir? A) 8 B) C) D) 2 E) 7 4. Kas içi (i.m) enjeksiyon, genelliklehangikasayapılır? A) M.Deltoides B) M.Bicepsbrachi C) M.Gluteus D) M.Trapezius E) M.Diyafragma. Aşağıdakilerdenhangisi, kafatasındagörüleneklemlerdir? A) Syncondrosis B) Gomphosis C) Syndesmosis D) Sutura E) Synovial eklem CevapAnahtarı A 2 B 3 B 4 C D KaynakKitap Yıldırım M. ResimliİnsanAnatomisi. 4. Basım. Nobel Kitapevi. İstanbul. 27 8

82 Dersin Kazanı Okul Program Ders Konu Kazanım Kodu YardımcıKaynaklarve Okuma Listesi Arıncı K, Elhan A. Anatomi. Cilt. 4. Baskı. Ankara: GüneşKitabevi, 26. R. Putz, R. Pabst. SobottaİnsanAnatomisiAtlası, 22. baskıdançeviri, &. Türkçebaskı. Çevirieditörü: A. Elhan. Beta, İstanbul, 26 FTP-3 FİZYOLOJİ ÖğretimÜyesi Şeyma Oda Numarası E-posta DersZamanı Derslik DersinAmacı Öğrencilerininsanvücudunuoluşturanhücre, doku, organ vesistemlerinişlevlerihakkındabilgi, becerivesonrakidönemlerdegöreceğiderslere alt yapıkazanmalarınısağlamak. Konuveilgilikazanım 39 7 FTP FTP3.. FizyolojiyeGirişVeFizyolojikKavramlar 39 7 FTP FTP3.. Insanvücudununkimyasal, hücreselvedokudüzeyindekiorganizasyonuhakkındabilgisahibiolur 39 7 FTP FTP3..2 Extraselülersıvı-içortamıbilir 39 7 FTP FTP3..3 Homeostazistanımlayabilir 39 7 FTP FTP3..4 Vücudunkontrolsistemlerinibilir 39 7 FTP FTP3.2. Hücrefizyolojisi 39 7 FTP FTP3.2. Hücrelerinfonksiyonelözelliklerinibilir 39 7 FTP FTP3.2.6 Hücrelerinyapısalözelliklerinibilir 39 7 FTP FTP3.2.7 Hücrezarımembranı, hücrezarınınyapısınıkavrar 39 7 FTP FTP3.2.8 Hücrezarındakitaşımaolaylarınıaçıklayabilir 39 7 FTP FTP3.2.9 Sitoplazmaveyapısındabulunanorganelleriaçıklayabilir 39 7 FTP FTP3..2. Organelleringörevleriniaçıklayabilir 39 7 FTP FTP3.3.. Kan fizyolojisi 39 7 FTP FTP3.3.. Kanıntemelgörevlerinikavrar 39 7 FTP FTP3.3.2 Kanınşekillielemanlarınınvegörevleriniaçıklayabilir 39 7 FTP FTP3.3.3 Eritrositlerinoluşumu,yıkımıvedemirmetabolizmasınıbilir 39 7 FTP FTP3.3.4 Lökositoz-lökopenikavramlarınıaçıklar 39 7 FTP FTP3.3. Trombositleringörevlerinibilir 39 7 FTP FTP3.3.6 Hemostazolayınıkavrar 39 7 FTP FTP3.3.7 Kan gruplarıve Rh Faktörünübilir 39 7 FTP FTP3.4. Kas fizyolojisi 39 7 FTP FTP3.4.8 Iskeletkasınınhücreselorganizasyonuveyapısı; kas lifiyapısınıbilir 39 7 FTP FTP3.4.9 Kas kasılmaçeşitleriniaçıklayabilir 39 7 FTP FTP3.4.2 Kas liflerininyapısalvefonksiyonelözelliklerinikavrar 39 7 FTP FTP3.4.2 Kalpkasınınyapısınıbilir 39 7 FTP FTP Düz kas yapısınıbilir 39 7 FTP FTP3.. Sinirsistemifizyolojisi Merkezisinirsistemindeyeralanyapıları (serebralkorteks, 39 7 FTP FTP3..23 serebellum, beyinsapı, hipotalamus, thalamus, limbic sistem, bazal ganglia, ortabeyin) vegörevlerinikavrar 39 7 FTP FTP3..24 Periferiksinirsisteminikavrar 39 7 FTP FTP3..2 Otonomsinirsisteminikavrar 82

83 tat FTP FTP3..26 MSS ileperiferikinirsistemiarasındakifarklarıbilir 39 7 FTP FTP3.6. DolaşımSistemiFizyolojisi 39 7 FTP FTP Kalbinyapısınıveişlevlerinikavrar 39 7 FTP FTP Kalbinuyarıveiletisisteminiaçıklar 39 7 FTP FTP Kardiyakoutputuaçıklar 39 7 FTP FTP3.7. DolaşımsistemiFizyolojisi -II 39 7 FTP FTP3.7.3 Damarlarınyapısıveişlevlerinibilir 39 7 FTP FTP3.7.3 Kan basıncıvenabızkavramınıaçıklar 39 7 FTP FTP Sistemikdolaşımvepulmonerdolaşımıaçıklar 39 7 FTP FTP3.8. SolunumSistemiFizyolojisi 39 7 FTP FTP Solunumsistemindeyeralanyapılarıkavrar 39 7 FTP FTP Solunumsistemifonksiyonlarınıbilir 39 7 FTP FTP3.8.3 Inspirrasyon, ekspirasyon, kompliyanskavramlarınıaçıklar 39 7 FTP FTP Akciğerhacimvekapasitelerinibilir 39 7 FTP FTP Solunumgazlarınınıntaşınmasınıbilir 39 7 FTP FTP Solunmmerkeziniveişleyişinibilir 39 7 FTP FTP3.9. SindirimSistemiFizyolojisi 39 7 FTP FTP Sindirimsisteminioluşturanyapılarıvegörevlerinibilir 39 7 FTP FTP3.9.4 Mekanikveenzimatikparçalanmayıaçıklar 39 7 FTP FTP3.9.4 Ince vekalınbağırsaklarınmotilitesinibilir 39 7 FTP FTP Dışkılamarefleksinikavrar 39 7 FTP FTP Enteric sinirsistemi, pancreas,karaciğervesafrakesesininfonksiyonlarınıbilir 39 7 FTP FTP3.. ÜrinerSistemFizyolojisi 39 7 FTP FTP3..44 Boşaltımsistemindeyeralanyapılarıvefonksiyonlarınıkavrar 39 7 FTP FTP3..4 Nefronunbölümlerinibilir 39 7 FTP FTP3..46 Idraroluşumununfizyolojisinikavrar 39 7 FTP FTP3.. EndokrinSistemveFizyolojisi 39 7 FTP FTP3..47 Hipotalamusvehipofizhormonlarınıvefonksiyonlarınıbilir 39 7 FTP FTP3..48 Tiroidveparatiroidhormonlarınıvefonksiyonlarınıbilir 39 7 FTP FTP3..49 Böbreküstübezihormonlarınıvefonksiyonlarınıbilir 39 7 FTP FTP3.. Pancreas hormonlarınıvefonksiyonlarınıbilir 39 7 FTP FTP3.. Cinsiyethormonlarınıvefonksiyonlarınıbilir 39 7 FTP FTP3.2. ÜremeFizyolojisi 39 7 FTP FTP3.2.2 Erkeküremesistemindeyeralanyapılarıvefonksiyonlarınıkavrar 39 7 FTP FTP3.2.3 Dişiüremesistemindeyeralanyaoılarıvefonksiyonlarınıkavrar 39 7 FTP FTP3.3. DuyuFizyolojisi 39 7 FTP FTP3.3.4 Görmeduyusufizyolojisinibilir 39 7 FTP FTP3.3. Koku duyusufizyolojisinibilir 39 7 FTP FTP3.3.6 Işitmevedengeduyusunubilir 7 FTP FTP3.3.7 Tat duyusunubilir Hafta-Tarih DersKonuları İlgili Program Yeterliği Eylül 29 UyumHaftası 2 3 Eylül 29 FizyolojiyeGirişVeFizyolojikKavramlar PY3-PY9 3 7Ekim 29 HücreFizyolojisi PY3-PY9 4 4 Ekim 29 Kan Fizyolojisi PY3-PY9-PY 2 Ekim 29 Kas Fizyolojisi PY3-PY Ekim 29 SinirSistemiFizyolojisi PY3-PY9 7 4Kasım 29 DolaşımSistemiFizyolojisi PY3-PY 9-7 Kasım 29 Ara Sınav 8 8Kasım 29 DolaşımSistemiFizyolojisi PY3-PY 9 2Kasım 29 SolunumSistemiFizyolojisi PY3-PY 2Aralık 29 SindirimSistemiFizyolojisi PY3-PY 9Aralık 29 ÜrinerSistemFizyolojisi PY3-PY9-PY 2 6Aralık 29 EndokrinSistemFizyolojisi PY3-PY9-PY 3 23Aralık 29 ÜremeFizyolojisi PY3PY9-PY 83

84 4 3 Aralık 29 DuyuSistemiİşlevleri PY3PY9-PY 4-2 Ocak 22 DönemSonuSınavı 2-26 Ocak 22 BütünlemeSınavı Bu dersindeğerlendirmesi, Değerlendirme kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır.. Aşağıdakilerdenhangisitükürüksalgısınıngörevlerindenbirideğildir? a) Lipitsindirimininbaşlatılması b) Gıdalarınnemlendirilipkayganlaştırılarakkolaycayutulabilir hale getirilmesi c) Besinmoleküllerinineritilerektadlarınınalınmasınayardımcıolma d) Bakterilerinkontrolaltınaalınması 2. Aşağıdakilerdenhangisi, parasempatiksisteminorganlarüzerineetkilerindendeğildir? a) Gözbebeğidaralır c) Tükrüksalgısıartar b) Bronşiollerdaralır d) Mideninsindirimfonksiyonuazalır 3. Pankreasın beta hücrelerindensalgılanan, kanglikozseviyesinidüşürenhormonaşağıdakilerdenhangisidir? a) Glukagon b) İnsülin c) Somatostatin d) Pankreatikpolipeptit CevapAnahtarı - a 2-d 3-b KaynakKitap KOZ, Mitat; ERSÖZ, Gülfem; GELIR, Ethem. Fizyolojiderskitabı. Nobel, 23. YardımcıKaynaklarve Okuma Listesi Guyton, Hall. TıbbiFizyoloji El Kitabı,. baskıdançeviri, &Türkçebaskı. Çevirieditörü: Solakoğlu Z., Nobel TıpKitabevi, 2 FTP- MİKROBİYOLOJİ ÖğretimÜyesi Şeyma Oda Numarası E-posta 84

85 DersinK azanıml Okul Program Ders Konu Kazanım Kodu DersZamanı Derslik DersinAmacı Mikroorganizmalarıngenelözellikleri, yapısı, mikroorganizma-çevre-organizmailişkileri, kemoterapötiklerinvedezenfektanlarınözellikleri, mikrobiyolojiktanıyöntemleriveantimikrobiyalduyarlılıktestlerikonularındabilgisahibiöğr enciyetiştirmek Konuveilgilikazanım 39 7 FTP 39.7.FTP.. MikrobiyolojiyeGiriş 39 7 FTP 39.7.FTP.. Mikrobiyolojinintarihçesihakkındabilgisahibiolur 39 7 FTP FTP..2 Bakteri, virus, parazitvefunguslarıngenelözelliklerinikavrar 39 7 FTP FTP..3 Mikroorganizmalarınasılsınıflandırılacağını, adlandırılacağınıbilir 39 7 FTP FTP.2. Mikroskoplar, MikrobiyolojideKullanılanDiğerAraçveGereçler 39 7 FTP FTP.2.4 Mikroskoptarihçesinibilir 39 7 FTP FTP.2. Mikroskopunbölümlerinivefonksiyonlarınıaçıklayabilir 39 7 FTP FTP.2.6 Mikroskopçeşitleriniaçıklayabilir 39 7 FTP FTP.2.7 Mikrobiyolojilabaratuvardakullanılandiğeraraçgereçlerinnelerold uğunuvefonksiyonlarınıbilir 39 7 FTP FTP.3. BakterilerinYapıveFizyolojileri 39 7 FTP FTP.3.8 Bakterihücresininyapısınıbilir 39 7 FTP FTP.3.9 Mikroorganizmalarınkimyasalyapılarınıbilir 39 7 FTP FTP.3. Mikroorganizmalarınüremesineetkiedenfaktörleriaçıklayabilir 39 7 FTP FTP.3. Mikroorganizmaenzimlerinivemetabolizmalarınıbilir 39 7 FTP FTP.4. BakteriGenetiğiveAntimikrobikMaddeler 39 7 FTP FTP.4.2 Mikroorganizmalarınkimyasalyapılarınıbilir 39 7 FTP FTP.4.3 DNA verna nınyapısınıvefonksiyonlarınıkavrar 39 7 FTP FTP.4.4 Protein senteziaşamalarınıbilir 39 7 FTP FTP.4. Antimikrobikmaddelerleilgilikavramlarıtanımlayabilir 39 7 FTP FTP.4.6 Antimikrobikilaçlarınetkimekanizmalarınıbilir 39 7 FTP FTP.4.7 Akıllıantibiyotikkullanımıkonusunuaçıklar 39 7 FTP 39.7.FTP.. MikroorganizmalarınÜretildiğiOrtamlarıveTanımlanmaları 39 7 FTP FTP..8 Mikroorganizmalarınüretildiğicanlıvecansızortamlarıbilir 39 7 FTP FTP..9 Genelveözelbesiyerleribilir 39 7 FTP FTP..2 Besiyerlerininhazırlanmasındakullanılarnmaddeleribilir 39 7 FTP FTP..2 Mikrobiyolojilaboratuvarındasıkçakullanılanbesiyerlerive ne amaçlakullanıldığıbilir 39 7 FTP FTP.6. BoyalarveBoyamaYöntemleri 39 7 FTP FTP.6.22 Mikrobiyolojidekullanılanboyamayöntemiaşamalarınıbilir 39 7 FTP FTP.6.23 Basitvebileşikboyamayöntemleriniveçeşitleriniaçıklar 39 7 FTP FTP.6.24 Mantar, virus veparazitboyamayöntemlerinibilir 39 7 FTP FTP FTP FTP FTP FTP.7.26 Mikroorganizmalarınhareketmuayenesindekullanılanyöntemleriaç ıklar ÇevreMikrobiyolojisi, Örnek Alma TeknikleriVe Normal MikrobiyalFloralar Mikroorganizmaların Birbirleriyle, Çevre ve Organizma ile İlişkilerini bilir 39 7 FTP FTP.7.27 Geçicivekalıcı flora arasındakifarkıaçıklar 39 7 FTP FTP.7.28 Vücudunçeşitlibölgesininflorasınıbilir 39 7 FTP FTP.7.29 Mikrobiyolojik örnekler alırken bilinmesi gereken kuralları açıklar 39 7 FTP FTP.7.3 Kan kültürü, idrarkültürü, balgamvediğerkültürörneklerinialınmaaşamalarınıvedikkatedilme sigerekenlerikavrar 39 7 FTP FTP.7.3 Mikrobiyoloji laboratuvarına gelen örneklerle yapılan işlemleri bilir 8

86 39 7 FTP FTP.8. SterilizasyonveDezenfeskiyon 39 7 FTP FTP.8.32 Merkezisterilizasyonünitesininyapısınıveişleyişinibilir 39 7 FTP FTP.8.33 Sterilizasyon, dezenfeskiyon, asepsi, antisepsikavramlarınıtanımlar 39 7 FTP FTP.8.34 El yıkamaçeşitlerinibilir 39 7 FTP FTP.8.3 Sosyalvehijyenik el yıkamaaşamalarınıuygular 39 7 FTP FTP.8.36 Cerrahi asepsis ilkeleriniaçıklar 39 7 FTP FTP.8.37 Dezenfeksiyonunamacını, öneminiveyöntemlerinibilir 39 7 FTP FTP.8.38 Fizikselvekimyasalsterilizasyonyöntemleriniaçıklar 39 7 FTP FTP.9. ImmünolojiyeGirişveAntijen 39 7 FTP FTP.9.39 Antijeninyapısınıveantijendebulunmasıgerekenözellikleribilir 39 7 FTP FTP.9.4 Antijençeşitlerinibilir 39 7 FTP 39.7.FTP.. ImmünSisteminYapısı 39 7 FTP FTP..4 Immüncevaptayeralanorganlarıvefonksiyonlarınıbilir 39 7 FTP FTP..42 Immüncevaptaroloynayanhücrelerivefonksiyonlarınıbilir 39 7 FTP 39.7.FTP.. Immünglobulinler(Antikorlar) veimmuncevap 39 7 FTP FTP..43 Antikorlarınınyapısınıveantikorçeşitlerinibilir 39 7 FTP FTP..44 Antijen-antikorbirleşmesinibilir 39 7 FTP FTP.2. DoğalDirenç, AşılarveBağışıkSerumlar 39 7 FTP FTP.2.4 Bağışıklıktipleriniaçıklar 39 7 FTP FTP.2.46 Aşılamaileilgilibazıkavramlarıtanımlar 39 7 FTP FTP.2.47 Aşılarınuygulanmasıileilgiliözellliklerivedikkatedilmesigerekenle riaçıklar 39 7 FTP FTP.2.48 Sağlıkbakanlığıaşıtakvimindeyeralanzorunluaşılarıbilir 39 7 FTP FTP.2.49 Aşıilebağışık serum arasındakifarkıaçıklar 39 7 FTP FTP.3. MikrobiyolojikTanıYöntemleri 39 7 FTP FTP.3. Mikrobiyolojilaboratuvarıveçalışmakurallarınıbilir 39 7 FTP FTP.3. Mikrobikhastalıklarıntanısındaizlenecekgenelilkeleribilir 39 7 FTP FTP.3.2 Muayenemaddesininmakroskobikvemikroskobikincelemesinibilir Hafta-Tarih DersKonuları İlgili Program Yeterliği Eylül 29 UyumHaftası 2 4Ekim 29 MikrobiyolojiyeGiriş PY9-PY 3 Ekim 29 Mikroskoplar, MikrobiyolojideKullanılanDiğerAraç,GereçVeCihazlar PY4-PY9 4 8 Ekim 29 BakterilerinYapıVeFizyolojileri PY9-PY 2Ekim 29 BakteriGenetiğiVeAntimikrobikMaddeler PY9-PY 6 Kasım 29 MikroorganizmalarınÜretildiğiOrtamlarVeTanımlanmaları PY9-PY 7 8 Kasım 29 BoyalarVeBoyamaYöntemleri PY4-PY9 9-7 Kasım 29 Ara sınav 8 22Kasım 29 ÇevreMikrobiyolojisi, Örnek Alma TeknikleriVe Normal MikrobiyalFloralar PY9-PY 9 29Kasım 29 SterilizasyonVeDezenfeksiyon PY9-PY 6Aralık 29 ImmünolojiyeGirişVeAntijen PY9-PY 3Aralık 29 ImmünSistemYapısı PY9-PY 2 2Aralık 29 ImmunglobulinlerVeImmünCevap PY9-PY 3 27Aralık 29 DoğalDirenç, AşılarVeBağışıkSerumlar PY9-PY 4 3 Ocak 22 MikrobiyolojikTanıYöntemleri PY4-PY9 4-2 Ocak 22 DönemSonuSınavı 2-26 Ocak 22 BütünlemeSınavı Bu dersindeğerlendirmesi, kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm Değerlendirme elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır. 86

87 ) Mikrobiyolojilabaratuvarındasıklıklakullanılan, Genellikle 37 C ye ayarlı, sabitısısağlayan metal malzemedenyapılmış, mikroorganizmalarınveyaklinikörneklerinbesiyerlerineekimiyapıldıktansonr abekletildiğicihazaşağıdakilerdenhangisidir? a) Otoklav b) Etüv c) Sterilizatörd) Santrifüj 2. Aşağıdakilerden hangisi, normal mikrop florasının özelliklerinden değildir? a) Aralarındaki denge bozulmadıkça hastalık oluşturmaz. b) Kalıcı flora herhangi bir sebeple ortadan kaldırılsa bile yeniden oluşur. c) Herhangi bir sebeple kaybolan geçici flora, aynı mikroorganizmalarla tekrar oluşur. d) Bulundukları yerleri değiştirmedikçe hastalık oluşturmaz. e) Organizmanın direnci düşmedikçe hastalık meydana getirmez. Örneksorular 3. Virüsler ile ilgili aşağıda verilen ifadelerden hangisi yanlıştır? a) En küçük mikroorganizmalardır b) Basit ışık mikroskobu ile incelenebilirler c) Tek tip nükleik asit içerirler d) Üretilmeleri özel teknikler gerektirir, güç ve masraflıdır CevapAnahtarı -b 2-c 3-b KaynakKitap Ustaçelebi Ş.: TemelveKlinikMikrobiyoloji. GüneşKitabevi, Ankara, 999 (ISBN: ) Başustaoğlu A.: KlinikMikrobiyoloji. 9. Baskı. Atlas Kitapcılık, Ankara, 29. (ISBN: ) YardımcıKaynaklarve Okuma Listesi AKŞİT, Filiz; AKGÜN, Yurdanur; KİRAZ, Nuri. Genelmikrobiyolojiveimmünoloji. Anadolu ÜniversitesiAçıköğretimFakültesiYayınları, Eskişehir, 99. FTP -7FİZİK TEDAVİDE ÖLÇME VE DEĞERLENDİRME ÖğretimÜyesi Oda Numarası E-posta DersZamanı Derslik DersinAmacı Fizyoterapideuygulanantemelölçmevedeğerlendirmeyöntemlerinindeğerlendirilmesidir. 87

88 Dersinkazanımları Okul Program Ders Konu Kazanım Kodu Konuveilgilikazanım 39 7 FTP FTP7.. Temelölçmevedeğerlendirme 39 7 FTP FTP7.. Temelölçmevedeğerlendirmakapsamındakikavramlarıöğrenir FTP FTP7.2. Hareketintemelprensipleri 39 7 FTP FTP7.2.2 Hareketetintemelprensipleriniöğrenir FTP FTP7.2.3 Eklemdüzlemintanımınıyapabilir FTP FTP7.3. Goniometrikölçümler 39 7 FTP FTP7.3.4 Goniometreyitanır FTP FTP7.3. Goniometrikölçümtekniklerinibilir FTP FTP7.4. Postüranalizi 39 7 FTP FTP7.4.6 Postürütanımlayabilir FTP FTP7.4.7 Postüranalizçeşitlerinibilir FTP FTP7.. Anterior analiz 39 7 FTP FTP7..8 Anterior postüranaliziniöğrenir 39 7 FTP FTP7..9 Anterior postüranaliziavantajvedezavantajlarınıbilir FTP FTP7.6. Posterior ve lateral analiz 39 7 FTP FTP7.6. Posterior ve lateral postüranaliziniöğrenir FTP FTP7.6. Hastada ne çeşitpostüranalizinikullanacağınıöğrenir FTP FTP7.7. Kas testigenelprensipler 39 7 FTP FTP7.7.2 Kas testigenelprensiplerinibilir FTP FTP7.7.3 Kas çeşitlerinibilir FTP FTP7.8. Üstekstremite kas testleri 39 7 FTP FTP7.8.4 Üstekstremitekaslarınıbilir FTP FTP7.8. Üstektremite kas test pozisyonlarınıbilir FTP FTP7.8.6 Üstekstremite kas testleriniuygulayabilir FTP FTP7.9. Alt ektremite kas testleri 39 7 FTP FTP7.9.7 Alt ekstremitekaslarınıbilir FTP FTP7.9.8 Alt ektremite kas test pozisyonlarınıbilir FTP FTP7.9.9 Alt ekstremite kas testleriniuygulayabilir FTP FTP7.. Gövde kas testleri 39 7 FTP FTP7..2 Gövdekaslarınıbilir FTP FTP7..2 Gövde kas test pozisyonlarınıbilir FTP FTP7..22 Gövdekastestleriniuygulayabilir FTP FTP7.. Antropometrikölçümler 39 7 FTP FTP7..23 Antropometrikölçümteknikleriniöğrenir FTP FTP7..24 Ölçümdekullanılanmalzemeleribilirvekullanabilir FTP FTP7.2. Kısalıkveesnekliktestleri 39 7 FTP FTP7.2.2 Kısalık test tekniklerinibilir FTP FTP Kısalıktestleriniuygulayabilir FTP FTP Esneklik test tekniklerinibilir FTP FTP Esnekliktestleriniuygulayabilir FTP FTP7.3. Skolyozdeğerlendirmesi 39 7 FTP FTP Skolyoztanımınıyapar FTP FTP7.3.3 Skolyoztürlerinibilir FTP FTP7.3.3 Skolyoztipiniadlandırmayıbilir FTP FTP Skolyozölçümtekniklerinibilir FTP FTP Skolyozölçümmetaryellerinibilir FTP FTP Skolyozölçümünüuygulayabilir. Hafta-Tarih DersKonuları İlgili Program Yeterliği Eylül 29 Uyum Haftası 2 EKİM 29 Temelölçmevedeğerlendirme PY2 3 8Ekim 29 Hareketintemelprensipleri PY3 88

89 4 Ekim 29 Goniometrikölçümler PY3 PY4 22Ekim 29 Postüranalizi PY3 PY4 6 2 Kasım 29 Anterior analiz PY3 PY4 7 Kasım 29 Posterior ve lateral analiz PY3 PY4 9-7 Kasım 29 Ara Sınav 8 9Kasım 29 Kas testigenelprensipleri PY3 PY4 9 26Kasım 29 Üstekstremite kas testleri PY9 3Aralık 29 Alt ekstremite kas testleri PY9 PY Aralık 29 HaftaGövdekaslarıtestleri PY9 PY 2 7Aralık 29 Antropometrikölçümler PY9 PY 3 24Aralık 29 Kısalikveesnekliktestleri PY9 PY 4 3Aralık 29 Skolyozdeğerlendirmesi PY PY 4-2 Ocak 22 DönemSonuSınavı 2-26 Ocak 22 BütünlemeSınavı Bu dersindeğerlendirmesi, Değerlendirme kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu Örneksorular üzerinden 6 tır..aşağıdakilerden hangisipelvikbölgevelumbalomurlarınkontrolvedüzgünlüğünüsağlamakiçinveri lebilecekegzersizlerdendeğildir? A)Kollarters T pozisyonundasırtüstüyatmışken posterior pelvik tilt yapılır, posterior pelviktiltikoruyaraktopuklaryerdesürülerekbacaklardüzleştirilir B)Kedi-deveegzersizi C)Eller ensedekenetli, yatakkenarındaotururkenyapılangeriyedoğruesnemeegzersizi D)Posterior pelvik tilt egzersizi E)Yüzüstü posterior pelvik tilt egzersizi 2.Lordotik postürdeağrıyanedenolandurumlararasındaaşağıdakilerdenhangisiyeralmaz? A)Posterior disk aralığınındaralması B)Anterior longitudinal bağdagerilimstresi C)Eklemyüzlerindeaproksimasyon D)İntervertebral foramenindaralması E)Ligamentum flavumdagerilimstresi 3.Hangisi spinal traksiyondavertebralararasındakiayrılmamiktarınıetkileyenfaktörlerdendeğildi r? A)Uygulamasüresi B)Çekmeaçısı C)Spinal kolonunpozisyonu D)Hastanınpozisyonu E)Kuvvetmiktarı 4.De Lormeyöntemiiçinhangisiyanlıştır? A)Amacıhastanınkaldırabileceğimaksimumağırlıkile o kasıkuvvetlendirmektir B)Bu yönteminuygulanabilmesiiçinkasınenaz 4 değerindeolmasıgerekir C)Hasta ilk olarak max tekrarın /2 sii kerekaldırır D)Sonra max tekrarın 3/4 ünü kerekaldırır E)En son max tekrarıntamamı kerekaldırılır. I. -2 dereceskolyozdatedavigerekmez II. 2-4 dereceskolyozdaegzersiz+ortezverilir III. 4 dereceüstüskolyozdacerrahigerekir Skolyoztedavisiiçinhangileridoğrudur? A)Yalnız I B)Yalnız II C) I ve II D) II ve III E)Hepsi 89

90 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu CevapAnahtarı.C 2.E 3.A 4.B.D KaynakKitap YardımcıKaynaklarve Okuma Listesi TedaviHareketlerindeTemelDeğerlendirmePrensipleri, S. Otman, H. Demirel, A. Sade, 23. Muscles Testing and Function with Posture and Pain, F.P.Kendall, 993 Muscles Testing and Function, F.P. Kendall ve ark., 983 Öğretim Üyesi FTP-9 TEMEL FİZİK Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Dersin temel amacı öğrencilere hareket kanunları, elektrik ve manyetik alan ve kanunları bilgisini temel düzeyde kazandırmak. Konu ve ilgili kazanım 39 7 FTR FTR9.. Ölçme, Vektörler 39 7 FTR FTR9.. Vektörlerin özelliklerini açıklar FTR FTR9..2 Vektörlerin bileşkelerini farklı yöntemleri kullanarak hesaplar. Bir vektörün kartezyen koordinat sistemindeki bileşenlerini FTR FTR9..3 çizmeleri ve bileşenlerinin büyüklüklerinin hesaplanması sağlanır 39 7 FTR FTR9..4 Vektörleri kartezyen koordinat sisteminde iki ve üç boyutlu çizer FTR FTR9.2. Bir ve iki boyutlu hareketler Bir cismin hareketini farklı referans noktalarına göre açıklar FTR FTR9.2. Gözlemlerle hareketin göreceli olduğu çıkarımının yapılması sağlanır FTR FTR9.2.6 Konum, alınan yol, yer değiştirme, süra t ve hız kavramlarını birbirleri ile ilişkilendirir FTR FTR9.2.7 Düzgün doğrusal hareket için konum, hız ve zaman kavramlarını ilişkilendirir FTR FTR9.2.8 İvme kavramını hızlanma ve yavaşlama olayları ile ilişkilendirir FTR FTR9.2.9 Sabit ivmeli hareket ile sınırlı kalınır FTR FTR9.2. Sabit ivmeli hareket için hız-zaman ve ivme- zaman grafiklerini çizmeleri, yorumlamaları ve grafikler arasında dönüşüm yapmaları sağlanır FTR FTR9.2. Anlık hız kavramına değinilir FTR FTR9.3. Newton kanunları 9

91 39 7 FTR FTR9.3.2 Dengelenmiş kuvvetlerin etkisindeki cisimlerin hareket durumlarını örneklerle açıklar 39 7 FTR FTR9.3.3 Kuvvet, ivme ve kütle kavramları arasındaki ilişkiyi açıkla 39 7 FTR FTR9.3.4 Serbest cisim diyagramı üzerinde cisme etki eden kuvvetler gösterilir. Net kuvvetin büyüklüğü hesaplanarak yönü gösterilir FTR FTR9.3. Etki-tepki kuvvetlerini örneklerle açıklar FTR FTR9.3.6 Yatay ve düşey düzlemlerde etki-tepki kuvvetlerinin gösterilmesi sağlanır FTR FTR9.3.7 Dengelenmiş kuvvetlerin etkisindeki cisimlerin hareket durumlarını örneklerle açıklar 39 7 FTR FTR9.4. İş, Güç, Enerji 39 7 FTR FTR9.4.8 İş, enerji ve güç kavramlarını birbirleriyle ilişkilendirir FTR FTR9.4.9 İş ile enerji arasındaki ilişki kavramsal olarak verilir FTR FTR9.4.2 Fiziksel anlamda iş ve güç ile günlük hayatta kullanılan iş ve güç kavramlarının farkları vurgulanır FTR FTR9.4.2 Mekanik iş ve mekanik güç ile ilgili hesaplamalar yapar FTR FTR9.. Enerjinin korunumu 39 7 FTR9 22 Enerjinin bir biçimden diğer bir biçime (mekanik, ısı, ışık, 39.7.FTR9..22 ses gibi) dönüşümünde toplam enerjinin korunduğu çıkarımını yapar FTR FTR9..23 Sürtünmeden dolayı enerjinin tamamının hedeflenen enerji biçimine dönüştürülemeyeceği vurgulanır FTR FTR9..24 Canlıların besinlerden kazandıkları enerjiile günlük aktiviteler için harcadıkları enerjiyi karşılaştırır FTR FTR9..2 Canlıların fiziksel anlamda iş yapmadan da enerji harcayabildikleri vurgulanır FTR FTR9.6. Momentumun korunumu 39 7 FTR9 Çizgisel momentumun korunumu bir ve iki boyutlu hareketle FTR sınırlandırılır FTR9 Öğrencilerin kuvvet-zaman grafiğinden alan hesaplamaları 27 yapmaları ve cismin momentum değişikliği ile FTR ilişkilendirmeleri sağlanır Enerjinin korunduğu ve korunmadığı durumlar göz önüne 39 7 FTR9 alınarak bir ve iki boyutta çizgisel momentumun korunumu, FTR çarpışmalar ve patlamalarla ilgili matematiksel hesaplamalar yapılması sağlanır 39 7 FTR FTR9.7. Katı cisimlerde kütle merkezi 39 7 FTR FTR Kütle ve ağırlık merkezi kavramlarının farklı olduğu durumlara değinilir FTR FTR9.7.3 Kütle merkezi ve ağırlık merkezi ile ilgili hesaplamalar yapar FTR FTR9.8. Rotasyonel Kinematik ve Dinamikler 39 7 FTR FTR9.8.3 Periyot, frekans, çizgisel hız ve açısal hız, merkezcil ivme kavramları verilir FTR FTR Öğrencilerin düzgün çembersel harekette çizgisel hız vektörünü çember üzerinde iki farklı noktada çizerek merkezcil ivmenin şiddetini bulmaları ve yönünü göstermeleri sağlanır 39 7 FTR FTR Katı cisimlerin sabit bir eksen etrafında dönme dinamiğini tork, eylemsizlik momenti ve dönme enerjisi kavramlarını kullanarak açıklar FTR FTR Katı cisimlerin yuvarlanma hareketini açısal momentum kavramını kullanarak açıklar FTR FTR9.9. Işığın özellikleri : yansıma ve kırılma 39 7 FTR FTR9.9.3 Işığın kırılmasını, ince ve kalın kenarlı mercekler kullanarak deneyle gözlemler 39 7 FTR FTR Kalın kenarlı merceklerin odak noktaları çizimle gösterilir 9

92 39 7 FTR FTR Ortam değiştiren ışığın izlediği yolu gözlemleyerek kırılma olayının sebebini ortam değişikliği ile ilişkilendirir FTR FTR Işığın yansımasında gelen ışın, yansıyan ışın ve yüzeyin normali arasındaki ilişkiyi açıklar 39 7 FTR FTR9.. Elektirksel alan ve elektriksel potansiyel 39 7 FTR FTR9..39 Yüklü cisimler arasındaki elektriksel kuvveti etkileyen değişkenleri belirler 39 7 FTR FTR9..4 Coulomb sabitinin (k), ortamın elektriksel geçirgenliği ile ilişkisi vurgulanır FTR FTR9..4 Noktasal yükler için elektriksel potansiyel enerji, elektriksel potansiyel, elektriksel potansiyel farkı ve elektriksel iş kavramlarını açıklar Öğrencilerin, noktasal yüklerin bir noktada oluşturduğu 39 7 FTR FTR9..42 elektrik potansiyeli ve eş potansiyel yüzeylerini tanımlamaları sağlanır 39 7 FTR FTR9..43 Düzgün bir elektrik alan içinde iki nokta arasındaki potansiyel farkını hesaplar 39 7 FTR FTR9.. Akın ohm yasası ve alternatif akımlar 39 7 FTR FTR9..44 Voltmetre ve ampermetrenin direnç özellikleri ile devredeki görevleri açıklanır 39 7 FTR FTR9..4 Öğrencilerin basit devreler üzerinden deney yaparak elektrik akımı, direnç ve potansiyel farkı arasındaki ilişkinin (Ohm Yasası) matematiksel modelini çıkarmalarısağlanır 39 7 FTR FTR9..46 Elektrik yükünün hareketi üzerinden elektrik akımı kavramının açıklanması sağlanır 39 7 FTR FTR9..47 Katı, sıvı, gaz ve plazmalarda elektrik iletimine değinilir 39 7 FTR FTR9.2. Manyetizma ve elektromanyetizma 39 7 FTR FTR Öğrencilerin deneyler yaparak veya simülasyonlar kullanarak manyetik alanı incelemeleri sağlanır 39 7 FTR FTR Mıknatısların manyetik alanının manyetik alan çizgileri ile temsil edildiği vurgulanır 39 7 FTR FTR9.2. Elektromıknatıs tanıtılarak kullanım alanlarına örnekler verilir 39 7 FTR FTR9.2. Öğrencilerin pusula ile yön bulmaları sağlanır FTR FTR9.3. Manyetizma ve elektromanyetizma Üzerinden akım geçen iletken düz bir telin çevresinde, 7 FTR FTR9.3.2 halkanın merkezinde ve akım makarasının (bobin) merkez 39 ekseninde oluşan manyetik alanın şiddetini etkileyen değişkenleri analiz eder. Hafta-Tarih Ders Konuları İlgili Program Yeterliği Eylül 29 UyumHaftası PY 2 EKİM 29 Ölçme, Vektörler PY2 3 8 Ekim 29 Bir ve iki boyutlu hareketler PY-PY2 4 Ekim 29 Newton kanunları PY-PY2 22 Ekim 29 İş, Güç, Enerji PY-PY2 6 2 Kasım 29 Enerjinin korunumu 7 Kasım 29 Momentumun korunumu PY-PY2 9-7 Kasım 29 Ara sınav 8 9 Kasım 29 Katı cisimlerde kütle merkezi PY-PY Kasım 29 Rotasyonel Kinematik ve Dinamikler PY-PY2 3 Aralık 29 Işığın özellikleri : yansıma ve kırılma PY-PY2 Aralık 29 Elektirksel alan ve elektriksel potansiyel PY-PY2 2 7 Aralık 29 Akın ohm yasası ve alternatif akımlar PY-PY2-PY 3 24 Aralık 29 Manyetizma ve elektromanyetizma PY-PY2-PY 4 3 Aralık 29 Manyetizma ve elektromanyetizma PY-PY2-PY 92

93 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu 4-2 Ocak 22 Yarıyıl sonu sınavları 2-26 Ocak 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas alınarak hazırlanacak olan klasik ve çoktan seçmeli soruları ile bir vize ve bir final Değerlendirme aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. ) 2m uzaklıktaki bir cisme 3 N luk kuvvet uygulanıyor. cismintorku kaç Nmdir? Örnek Sorular 2) Aşağıdakilerden hangisi yenilenemez enerji kaynaklarından biri değildir? a) Nükleer enerji b) Doğalgaz c) Kömür d)jeotermal e) Petrol 3) Şekilde verilen kuvvet yol grafiğinde yapılan Cevap Anahtarı Kaynak Kitap net iş kaç Jouldür? : T=F.d =3*2=6 Nm 2) d 3)(8*)-(*4)=4-2= 2 Joule Yalçın C. (986).Fiziğin Temelleri. Mekanik ve Termodinamik, Teori Yayınları Yardımcı Kaynaklar ve Okuma Listesi Yalçın C ve Apaydın E Fiziğin Temelleri: Problem Çözümleri II, Ayrım Yayınları, Ankara, 986. Hallıday D. (986).Fiziğin Temelleri Problem Çözümleri, Ayrım Yayınları FTP-TIBBİ TERMİNOLOJİ Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Bireyin sağlığı / hastalıkları ile ilgili tıbbi terimler hakkında bilgilerin verilmesi. Konu ve ilgili kazanım 39 7 FTP 39.7.FTP.. Giriş, insan yapısına ilişkin temel tanım ve terimler 39 7 FTP 39.7.FTP.. İnsan anatomisine ilişkin temel tanımları, ortak tanı yöntemlerini ve kısaltmaları kullanır FTP FTP.2. Tıbbi terimleri meydana getiren öğeler; kökler, ön ekler, son ekler 93

94 39 7 FTP FTP.2.2 Tıbbi terimlerde kökleri, tekil ve çoğul terimleri kullanır 39 7 FTP FTP.2.3 Tıbbi terimlerde konum, yer, miktar, eylem ve olumsuzluk bildiren ön ekleri kullanır 39 7 FTP FTP.3. İskelet sistemi tıbbi terimler 39 7 FTP FTP.3.4 Hareket sistemi ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini kullanır 39 7 FTP FTP.3. İskelet sistemi ve ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini kullanır FTP FTP.4. Solunum sistemi tıbbi terimler 39 7 FTP FTP.4.6 Solunum sitemi ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini kullanır 39 7 FTP 39.7.FTP.. Kardiovasküler sistem tıbbi terimler 39 7 FTP FTP..7 Kardiovasküler sitem ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini kullanır 39 7 FTP FTP.6. Kulak, buru,boğaz, Göz tıbbi terimler 39 7 FTP FTP.6.8 Kulak-Burun-Boğaz ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini kullanır 39 7 FTP FTP.6.9 Göz ile ilgili; anatomik, hastalık, semptom ve ameliyat terimlerini kullanır 39 7 FTP FTP.7. Üro-Genital sistem tıbbi terimler 39 7 FTP FTP.7. Üriner sistem ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini kullanır FTP FTP.7. Genital sistem ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini kullanır FTP FTP.8. Nörolojik ve Psikiyatri tıbbi terimler 39 7 FTP FTP.8.2 Tıbbi terimlerde konum, yer, miktar, eylem ve olumsuzluk bildiren ön ekleri kullanır 39 7 FTP FTP.9. Gastro-İntestinal sistem tıbbi terimler 39 7 FTP FTP.9.3 Sindirim sistemi ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini kullanır 39 7 FTP 39.7.FTP.. Dermatoli tıbbi terimler 39 7 FTP 4 Deri ile ilgili anatomik, hastalık, semptom ve ameliyat terimlerini 39.7.FTP..4 kullanır FTP 39.7.FTP.. Hematoloji tıbbi terimler 39 7 FTP Kan ve kan yapıcı organlar ile ilgili anatomik, hastalık, semptom 39.7.FTP.. ve ameliyat terimlerini kullanır FTP FTP.2. Endokrinoloji tıbbi terimler 39 7 FTP 2 6 Endokrin sistem ile ilgili anatomik, hastalık, semptom ve ameliyat 39.7.FTP.2.6 terimlerini kullanır FTP FTP.3. Meme hastalıkları tıbbi terimler 39 7 FTP 3 7 Meme hastalıkları ile ilgili anatomik, hastalık, semptom ve 39.7.FTP.3.7 ameliyat terimlerini kullanır. Hafta-Tarih Ders Konuları İlgili Program Yeterliği Eylül 29 UyumHaftası 2 4 Ekim 29 Giriş, insan yapısına ilişkin temel tanım ve terimler PY-PY6 3 Ekim 29 Tıbbi terimleri meydana getiren öğeler; kökler, ön ekler, son ekler PY-PY6 4 8 Ekim 29 İskelet sistemi tıbbi terimler PY-PY6-PY 2 Ekim 29 Solunum sistemi tıbbi terimler PY-PY6-PY 6 Kasım 29 Kardiovasküler sistem tıbbi terimler PY-PY6-PY 7 8 Kasım 29 Kulak, buru,boğaz, Göz tıbbi terimler PY-PY6-PY 9-7 Kasım 29 Ara Sınav 8 22 Kasım 29 Üro-Genital sistem tıbbi terimler PY-PY6-PY 9 29 Kasım 29 Nörolojik ve Psikiyatri tıbbi terimler PY-PY6-PY 94

95 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu 6 Aralık 29 Gastro-İntestinal sistem tıbbi terimler PY-PY6-PY 3 Aralık 29 Dermatoli tıbbi terimler PY-PY6-PY 2 2 Aralık 29 Hematoloji tıbbi terimler PY-PY6-PY 3 27 Aralık 29 Endokrinoloji tıbbi terimler PY-PY6-PY 4 3 Ocak 22 Meme hastalıkları tıbbi terimler PY-PY6-PY 4-2 Ocak 22 Yarıyıl sonu sınavları 2-26 Ocak 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. ) Hangi duyu talamusa uğramaz? a.dokunma b)koku c)görme d)işitme e)tatma Örnek Sorular 2)kemiklerin anatomi bozukluklarından kaburganın yanlara doğru çarpıklığıyla kendini gösteren deformite aşağıdakilerden hangisidir? a)scolyoz b)kifoz c)lordoz d)skinoz e)kifolordoz 3)inspirasyon tıp dilinde ne anlama gelmektedir? a)uyumak b) solunum c)soluk alma d)öksürmek e)yorgunluk Cevap Anahtarı )b 2)a 3)c Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi SÜZEN, Bikem; Sağlık Dili,. Baskı, Birol Basın Yayın Dağıtım ve Matbaacılık, Adil Artukoğlu, Aslan Kaplan, Ali Yılmaz, Tıbbi Terminoloji, 2. Baskı, Denge Matbaacılık, Ankara 24. Kutsal Yeşim Gökçe, Temel Geriatri,. Baskı, Güneş Kitabevi, Ankara 27. -Sebahat Ekinci, H. Gül hatipoğlu, Yüksek Okullarda Tıbbi Terminoloji, Hatipoğlu Yayınları, Sistem Ofset, Ankara 2. FTP-9 FİZİK TEDAVİ VE REHABİLİTASYON YÖNTEMİ I Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Fizik tedavi ile ilgili genel bilgilerin ve fizyoterapi prosedürünün anlatılması. Fizyoterapi ile ilgili uygulamaları öğretilmesi. Konu ve ilgili kazanım 39 7 FTP FTP9.. Fizyoterapiye giriş ve prosedürü 39 7 FTP FTP9.. Fizyoterapi kavramı öğrenir 39 7 FTP FTP9..2 Prosüdürleri öğrenir 9

96 39 7 FTP FTP9.2. Ağrı 39 7 FTP FTP9.2.3 Ağrıyı tanımlar 39 7 FTP FTP9.2.4 Nednelerini açıklar 39 7 FTP FTP9.3. Sıcak ve soğuk 39 7 FTP FTP9.3. Sıcağın vücut üzerinde etkisini öğrenir 39 7 FTP FTP9.3.6 Soğuğun vücut üzerinde etkisini öğrenir 39 7 FTP FTP9.4. Yüzeysel sıcaklar 39 7 FTP FTP9.4.7 Yüzeysel sıcaklık ajanlarını öğrenir 39 7 FTP FTP9.4.8 Etkilerini öğrenir 39 7 FTP FTP9.. İnfaruj ve Hot Pack 39 7 FTP FTP9..9 İnfraruju tanır 39 7 FTP FTP9.. Hot pack cihazı ve pedlerini tanır 39 7 FTP FTP9.6. Parafin 39 7 FTP FTP9.6. Parafin etkisini öğrenir 39 7 FTP FTP9.7. Derin Isıtıcılar 39 7 FTP FTP9.7.2 Derin ısı ajanlarını öğrenir 39 7 FTP FTP9.8. Kısa dalga diatermi 39 7 FTP FTP9.8.3 Kısa dalga diatermi cihazını ve etkisini öğrenir 39 7 FTP FTP9.9. Kaplıca tedavisi 39 7 FTP FTP9.9.4 Kaplıcanın yararlarını öğrenir 39 7 FTP FTP9.. Elektrik akımları 39 7 FTP FTP9.. Elektrik akım çeşitlerini öğrenir 39 7 FTP FTP9.. Elektrik akımları 39 7 FTP FTP9..6 Elektrik akımlarının etkilerini öğrenir 39 7 FTP FTP9.2. Tens, Enterfarrensiyel akım 39 7 FTP FTP9.2.7 TENS cihazını ve etkilerini öğrenir 39 7 FTP FTP9.2.8 Enterfarensiyel akımları ve etkilerini öğrenir 39 7 FTP FTP9.3. Galvanik ve faradik akım 39 7 FTP FTP9.3.9 Galvanik akımları ve etkilerini öğrenir 39 7 FTP FTP9.3.2 Faradik akımları ve etkilerini öğrenir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği Eylül 29 UyumHaftası PY 2 3 Eylül 29 Fizyoterapiye giriş ve prosedürü PY3PY4-PY 3 7 Ekim 29 Ağrı PY3PY4-PY 4 4 Ekim 29 Sıcak ve soğuk PY3PY4-PY 2 Ekim 29 Yüzeysel sıcaklar PY3PY4-PY 6 28 Ekim 29 İnfaruj ve Hot Pack PY3PY4-PY 7 4 Kasım 29 Parafin PY3PY4-PY 9-7 Kasım 29 Ara Sınav 8 8 Kasım 29 Derin Isıtıcılar PY3PY4-PY 9 2 Kasım 29 Kısa dalga diatermi PY3PY4-PY 2 Aralık 29 Kaplıca tedavisi PY3PY4-PY 9 Aralık 29 Elektrik akımları PY3PY4-PY 2 6 Aralık 29 Elektrik akımları PY3PY4-PY 3 23 Aralık 29 Tens, Enterfarrensiyel akım PY3PY4-PY 4 3 Aralık 29 Galvanik ve faradik akım PY3PY4-PY 4-2 Ocak 22 Yarıyıl sonu sınavları 2-26 Ocak 22 Bütünleme sınavları Değerlendirme Örnek Sorular Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas alınarak hazırlanacak olan çoktan seçmeli, boşluk doldurma, klasik ve D/Y bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. - Alçak frekaslı akımların fizyolojik etkilerini yazınız? 96

97 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Cevap Anahtarı 2- FTR de kullanılan US aletlerinde maksimum güç Watt ile sınırlandırılmıştır. 3- Biofeedback nedir? - Duyu sinirleri üzerine Motor sinirler üzerine Denerve kaslar üzerine -Kimyasal etkisi -Isı etkisi 2-3- Biyolojik ve otonom sinir sistemi tarafından otomatik olarak ayarlanan sistemlerin işitsel ve görsel sinyallerle bilinçli olarak kontrolü Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi Fiziksel Tıp ve Rehabilitasyon. Güneş Kitabevi Evcik D. (28). Kas İskelet Sisteminde Pratik Ölçme ve Değerlendirme. Pelikan Yayınevi Kutsal Y.G. Beyazova M. (2)..SINIF BAHAR DÖNEMİ DERS PLANLARI TÜRK DİLİ II Öğretim Üyesi Oda Numarası E-posta Yalçın KULAÇ MA-K-9 Ders Zamanı Derslik Dersin Amacı Uzaktan Eğitim Ön lisans ve lisans düzeyindeki öğrencilere kendilerini doğru ve etkili olarak doğru ifade etmeyi, ana dil bilinci edindirmeyi; panel, konferans, açık oturum, forum türü toplantıları etkili dinlemeyi öğretmektir. Konu ve ilgili kazanım 39 7 D9 39..D9.. Oryantasyon Haftası 39 7 D9 39..D9.. Dersin amacı, içeriği ve kaynakların tanıtılması D D9.2. Ses bilgisi 39 7 D D9.2.2 Ses bilgisi ile ilgili temel kavramları bilir D D9.2.3 Türkçedeki sesleri ve bu seslerin özelliklerini bilir D D9.2.4 Ünlülerle ilgili ses olaylarını ve nedenlerini bilir D D9.2. Ünlü düşmesini, ünlü daralmasını, ünlü türemesini bilir D D9.2.6 Ünsüzlerle ilgili ses olaylarını ve nedenlerini bilir D D9.2.7 Ünsüz düşmesini, ünsüz türemesini, ünsüz benzeşmesini bilir D D9.3. Cümle Türleri: Anlamına göre cümleler 39 7 D D9.3.8 Cümle ile ilgili kavramları bilir. 97

98 39 7 D D D D9.4. Cümle Türleri: Yapısına göre cümleler 39 7 D D9.4. Olumlu cümleyi, olumsuz cümleyi, soru cümlesini, ünlem cümlesini bilir. Basit cümleyi, birleşik cümleyi, sıralı cümleyi, bağlı cümleyi bilir D D9.. Sözcük türleri: isim ve isim öbekleri 39 7 D D9.. Sözcük türü ile ilgili kavramları bilir D D9..2 Sözcük türlerini anlam, tür ve görev bakımından sınıflandırır D D D D9.6. Zamirler 39 7 D D D D9.7. Sıfat ve sıfat öbekleri 39 7 D D D D9.8. Zarflar 39 7 D D D D9.9. Eylemler 39 7 D D D D9.. Ek eylemler 39 7 İsmin tanımını, özelliklerini ve isim öbeklerinin çeşitlerini bilir. Metin içerisinde isim ve isim öbeklerini bulur. Zamirin tanımını, özelliklerini ve zamir çeşitlerini bilir. Metin içerisinde zamirleri ve zamir çeşitlerini bulur. Sıfatın tanımını, özelliklerini ve sıfat türlerini bilir. Metinde sıfatı ve sıfat türlerini bulur. Zarfın tanımını ve zarf türlerini bilir. Metin içerisinde zarf ve zarf türlerini bulur. Eylemin tanımını ve özelliklerini bilir. İsim ve eylem ayrımına varır. Metin içerisinde eylemleri bulur. Ek eylem nedir? bilir. Eylemin özelliklerini kavrar. Metin içerisinde ek eylemin bulur. D D D D9.. Eylemsiler 39 7 D D D D9.2. Edat 39 7 D D D D9.3. Bağlaç 39 7 D D D D9.4. Yazılı ve sözlü anlatım türler D9 4 Eylemsilerin tanımını yapar, özelliklerini bilir. Metin içerisinde eylemsileri bulur. Edat nedir? bilir. Edatın özelliklerini kavrar. Edat türlerini bilir. Metin içerisinde edatları bulur. Bağlaç nedir? bilir. Bağlacın özelliklerini kavrar. Bağlaç türlerini bilir. Metin içerisinde edatları bulur. Yazılı anlatım türlerini bilir: Form yazılar, öz geçmiş, biyografi, dilekçe, rapor, tutanak, mektup yazılarının tanımını D ve özelliklerini bilir. Örnek yazılar okur. Makale, deneme, fıkra, eleştiri, röportaj, anı / hatıra, gezi / seyahat yazılarının tanımını ve özelliklerini bilir. Örnek D D yazılar okur. D9 D D D9.4.2 Etkili konuşma becerisinin önemini kavrar. İyi bir konuşmacının özelliklerini öğrenir. Sözlü anlatım türlerinden konferans, açık oturum, panel ve münazaranın tanımını ve özelliklerini bilir. Seminer, kongre, sempozyum, forum gibi sözlü anlatım türlerinin tanımınıve özelliklerini bilir. Örnek yazılar okur. Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 UyumHaftası Şubat 22 Ses bilgisi PY Şubat 22 Cümle Türleri: Anlamına göre cümleler PY Mart 22 Cümle Türleri: Yapısına göre cümleler PY4 9-3 Mart 22 Sözcük türleri: isim ve isim öbekleri PY Mart 22 Zamirler PY Mart 22 Sıfat ve sıfat öbekleri PY4 98

99 28 Mart- Nisan 22 Ara sınavlar Nisan 22 Zarflar PY Nisan 22 Eylemler PY Nisan 22 Ek eylemler PY4 27 Nisan- Mayıs 22 Eylemsiler PY Mayıs 22 Edat PY4 3 - Mayıs 22 Bağlaç PY Mayıs 22 Yazılı ve sözlü anlatım türleri PY4 3 Mayıs-7 Haziran 22 Final sınavları -2 Haziran 22 Bütünleme sınavları Değerlendirme Bu dersin değerlendirmesi çoktan seçmeli bir ara sınav ve bir dönem sonu sınavı aracılığıyla yapılacaktır. Ara sınavın ortalamaya katkısı % 4 dönem sonu sınavının ise % 6 tır. Geçme notu üzerinden 6 tır.. Aşağıdaki atasözlerinin hangisinde ünsüz benzeşmesinin örneği yoktur? A) Irmaktan geçerken at değiştirilmez. B) Herkesin geçtiği köprüden sen de geç. C) Her şeyin yokluğu yokluktur. D) İyi olacak hastanın hekim ayağına gelir. E) Değirmen iki taştan, muhabbet iki baştan. 2. Ben güzel günlerin şairiyim." cümlesiyle yapısı, yükleminin yeri ve türü yönünden aşağıdaki dizelerin hangisi özdeştir? A) Saadetten alıyorum ilhamımı. B) Kızlara çeyizlerinden bahsediyorum. C) Çocuklara müjdeler veriyorum. D) Babası cephede kalan çocuklara. E) Ben ümitsizlere ümidim. Örnek Sorular 3. Aşağıdaki cümlelerin hangisi yapısına göre basit, söz dizimine göre devrik bir cümledir? A) Okulda tiyatro çalışması yapmayı düşünüyor. B) Şiiri güzel okuyanlar, toplanmış salonda. C) Herkese laf anlatıyor, kimseyi incitmiyor. D) Bir dergi çıkaracağını söylemişti geçen gün. E) Hikâyelerini bir kitapta topladı bu sene. 4. Aşağıdakilerden hangisinde ikileme zarf fiillerle kurulmuştur? A) Sabah hızlı hızlı yürüyordu. B) Bir köşede ileri geri konuştular. C) Çocuk düşe kalka büyür. D) İşleri sonra sonra yoluna girdi. E) Gece gündüz demeden çalıştı. Cevap Anahtarı.Aşağıdaki cümlelerden hangisinde fiilimsi yoktur? A) Dün gölge veren ağaç, bugün ocakta yandı. B) Güneşli bir havada yaylımız yola çıktı. C) Gün doğarken bir ölüm rüyasıyla uyandım. D) Yedi yüz yıl süren hikâyemizi dinlemiş. E) Seninle gelmesini istemez misin?. D 2. E 3. E 4.C. B Prof. Dr. Hanifi Vural, Türk Dili, Taşhan Kitap, Tokat, 22. Yardımcı Kaynaklar ve Prof. Dr. Hanifi Vural, Türk Dili, Taşhan Kitap, Tokat,

100 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Okuma Listesi.Prof. Dr. Muharrem Ergin, Türk Dil Bilgisi, Bayrak Yayınları, İstanbul, Prof. Dr. Tahsin Banguoğlu, Türkçenin Grameri, TDK Yayınları, Ankara, Prof. Dr. Mustafa Özkan vd.; Yükseköğretimde Türk Dili Yazılı ve Sözlü Anlatım, Filiz Kitabevi, İstanbul, Prof. Dr. Mehmet Kaplan, Dil ve Kültür, Dergâh Yayınları, İstanbul, 2.. Ertem, Rekin - İsa Kocakaplan, Üniversitelerde Türk Dili ve Kompozisyon 6. Serdar Odacı vd., Üniversiteler için Dil ve Anlatım, Palet Yay., Konya, Türkçe Sözlük, TDK Yayınları, Ankara, Yazım Kılavuzu, TDK Yayınları, Ankara, 22. ATATÜRK İLKELERİ VE İNKILAP TARİHİ II Öğretim Üyesi Dr. Ayşe ERYAMAN Oda Numarası 2 E-posta Ders Zamanı Perşembe, 8.-. Derslik Dersin Amacı Uzaktan Eğitim Türkiye Cumhuriyeti devletinin kuruluş şartlarının ve özelliklerinin anlaşılabilmesi için; Türk Milleti ni Kurtuluş Savaşı yapmak durumunda bırakan şartlarla, Kurtuluş Savaşı nın hangi şartlarda ve hangi ilkeler çerçevesinde gerçekleştiğini ve devletin hangi esaslar üzerine kurulduğunu kavratmak; böylece devletin kuruluş felsefesini bilen, devletinin ve milletinin temel değerlerine saygılı bireyler yetiştirmek. Konu ve ilgili kazanım 39 7 D D7.. Milli Mücadele 39 7 D D7.. TBMM ye karşı çıkan ayaklanmaları bilir. TBMM ye karşı çıkan ayaklanmaların Milli Mücadele 39 7 D D7..2 üzerindeki etkilerini değerlendirebilir. Sevr Antlaşması ile emperyalist güçlerin Anadolu üzerindeki 39 7 D D7..3 emellerini değerlendirebilir. Türk Milleti nin Sevr Antlaşması na verdiği tepkileri 39 7 D D7..4 değerlendirebilir. Milli Mücadele de Doğu Cephesi nde yaşanan askeri ve siyasi 39 7 D D7.. gelişmeleri kavrar. Milli Mücadele de ilk askeri ve siyasi zaferin kime karşı 39 7 D D7..6 kazanıldığını bilir. Milli Mücadele de Güney Cephesi nde yaşanan askeri ve siyasi 39 7 D D7..7 gelişmeleri kavrar. Kuva-yı Milliye birliklerinin faaliyetlerini ve düzenli ordunun 39 7 D D7..8 kurulma sürecini bilir. Milli Mücadele de Batı Cephesi nde yaşanan askeri ve siyasi 39 7 D D7..9 gelişmeleri kavrar. Milli Mücadele de Doğu, Güney ve Batı Cepheleri nde elde 39 7 D D7.. edilen başarıları ve bu başarıların Türk Milleti açısından önemini açıklayabilir D D7.2. Milli Mücadele Mudanya Ateşkes Antlaşması nın Milli Mücadele deki yeri ve 39 7 D D7.2. önemini kavrar. Milli Mücadele nin askeri safhasının Mudanya Ateşkes 39 7 D D7.2.2 Antlaşması ile bittiğini bilir D D7.2.3 Lozan Antlaşması nın Türk Milleti ne sağladığı kazanımları

101 analiz eder. Türk Milleti nin bağımsızlığını sınırlayan kapitülasyon, azınlık hakları, dış borçlar gibi unsurlardan Milli Mücadele de 39 7 D D7.2.4 kazanılan askeri başarılar ve Lozan Antlaşması ile verilen siyasi mücadeleler ile kazanıldığını kavrar. Türkiye nin uluslararası platformda tam bağımsız bir güç olarak 39 7 D D7.2. tanınması sürecini değerlendirebilir. Tarihsel süreçte ve günümüzde Lozan Antlaşması nın Türk 39 7 D D7.2.6 Milleti için önemini açıklayabilir D D7.3. Türkiye Cumhuriyeti nin Kuruluşu Türkiye de saltanat ve halifeliğin kaldırılma süreçlerini 39 7 D D7.3.7 değerlendirebilir D D7.3.8 Cumhuriyet kavramının ne anlama geldiğini bilir. Atatürk ün Cumhuriyetçilik ilkesini ve dayandığı temel esasları 39 7 D D7.3.9 kavrar. Atatürkçü Düşünce Sistemi içinde Cumhuriyetçilik ilkesinin 39 7 D D7.3.2 yerini ve önemini açıklayabilir. Atatürk dönemi Türk demokratikleşme sürecinin ilk aşamalarını 39 7 D D7.3.2 değerlendirebilir D D7.4. Cumhuriyetin Demokratikleşmesi Halk Fırkası nın, Terakkiperver Cumhuriyet Fırkası nın, Serbest Cumhuriyet Fırkası nın ve Demokrat Parti nin kuruluşunu, 39 7 D D benimsediği temel ilkeleri ve bu partilerin Türk siyasi tarihi içindeki yeri ve önemini bilir. Türkiye Cumhuriyeti nin kuruluşundan sonraki süreçte yaşanan 39 7 D D siyasi gelişmeleri değerlendirebilir. Türkiye Cumhuriyeti nin kuruluş yıllarındaki demokratikleşme 39 7 D D yolunda atılan adımları analiz edebilir. Türkiye de çok partili siyasi hayata geçiş sürecini 39 7 D D7.4.2 değerlendirebilir. Demokratik bir sistem için siyasi partilerin ve çok partili 39 7 D D yaşamın gerekliliğini kavrar D D Atatürk ün Halkçılık ilkesini ve önemini açıklayabilir D D Atatürk ün Halkçılık ilkesinin dayandığı temel esasları bilir. Halkçılık ilkesinin milli egemenliğin ve eşitliğin temel dayanağı 39 7 D D olduğunu bilir D D7.. Cumhuriyet in Laikleşmesi 39 7 D D7..3 Laiklik kavramının ne almama geldiğini bilir D D7..3 Atatürk ün Laiklik ilkesi ve önemini açıklayabilir D D7..32 Türkiye nin siyasi, hukuk ve eğitim alanlarındaki laikleşme sürecini değerlendirebilir D D7..33 Hukuksal alanda yapılan inkılâpların gerekçelerini bilir D D7..34 Hukuk alanında yapılan inkılâpların dayandığı esasları bilir. Türk Medeni Kanunu ile Türk aile yapısında ve kadının 39 7 D D7..3 toplumsal statüsünde meydana gelen değişiklikleri değerlendirebilir D D7.6. Milliyetçilik İlkesi 39 7 D D Milliyetçilik kavramının ne anlama geldiğini tanımlayabilir D D Milliyetçilik kavramının nasıl ortaya çıktığını ve dünya üzerindeki etkilerini açıklayabilir D D Türk milliyetçiğinin gelişim safhalarını değerlendirebilir D D Atatürk ün Milliyetçilik ilkesini ve dayandığı temel esasları açıklayabilir D D7.6.4 Milli tarih ve dil bilincinin yeri ve önemini bilir D D7.6.4 Milliyetçilik ilkesi doğrultusunda yapılan inkılâp hareketlerini bilir ARA SINAV 39 7 D D7.7. Devletçilik İlkesi

102 39 7 D D Ekonomi alanında meydana gelen gelişmeleri kavrar D D Tam bağımsız ve milli bir ekonomi düzeni kurmak için İzmir İktisat Kongresi nde alınan kararları değerlendirebilir D D Tam bağımsız bir ekonominin bir millet için ne kadar önemli olduğunu kavrar D D Dünya Ekonomik Bunalımı nın Türkiye üzerine etkilerini değerlendirebilir D D Atatürk ün Devletçilik ilkesinin ne anlama geldiğini ve önemi açıklayabilir. Devletçilik ilkesinin Türkiye nin o günkü ihtiyaçlarından 39 7 D D doğmuş olduğunu ve dünyadaki diğer ekonomik sistemlerden farklı yönlerini bilir D D7.8. İnkılâplara Tepkiler 39 7 D D Cumhuriyet in ilk yıllarında Türkiye Cumhuriyeti ne yönelik tehditleri analiz edebilir D D Mustafa Kemal e suikast girişimini analiz edebilir D D7.8. Şeyh Sait ve Menemen Olaylarını amaçlarını değerlendirebilir D D7.9. Türk Tarihinin Anayasaları ve Özellikleri 39 7 D D7.9. Anayasa kavramının ne anlama geldiğini bilir D D D D D D D D D D7.9.6 Dünyada anayasa kavramının ilk ve ne şekilde ortaya çıktığını ve dünyadaki anayasal gelişmelerin Osmanlı Devleti üzerindeki etkilerini değerlendirebilir. Osmanlı Devleti nde yaşanan anayasal gelişmeleri, 876 Anayasası ve özelliklerini, 99 yılı değişikliklerini siyasi ve kişisel hak ve özgürlükler açısından değerlendirebilir. Türkiye Cumhuriyeti nin 92, 924, 96, 982 Anayasası olmak üzere dört anayasal süreç yaşadığını bilir. 92, 924, 96, 982 Anayasaları nın uygulanmasını hazırlayan siyasi süreçlerde yaşanan olayları, bu anayasaların temel özelliklerini ve uygulanmasından doğan toplumsal ve siyasi sonuçları değerlendirebilir. Türkiye de kişisel hak ve özgürlükler konusunda yaşanan gelişmeleri değerlendirebilir D D7.. Eğitim İnkılâbı 39 7 D D7..7 Eğitim alanında yapılan inkılâpların gerekçelerini bilir D D7..8 Atatürk ün milli ve çağdaş eğitime verdiği önemi kavrar D D7..9 Eğitim ve kültür alanında yapılan gelişmeleri kavrar D D D D D D7..62 Tevhid-i Tedrisat Kanunu, Harf İnkılâbı, Millet Mektepleri nin yeni bir eğitim sistemi kurulması içindeki yeri ve önemini değerlendirebilir. Köy Enstitüleri nin kuruluş amacını, işleyiş biçimini ve Türk eğitim sistemi içindeki yeri ve önemini değerlendirebilir. Yükseköğretim alanında yapılan yeni düzenlemeler ve Üniversite Reformu konusunda atılan ilk adımları değerlendirebilir D D7.. Toplumsal Alanda Yapınla İnkılâplar Toplumsal alanda yapılan inkılâpları ve meydana gelen 39 7 D D7..63 gelişmeleri kavrar D D7..64 Şapka ve kıyafet alanında yapılan düzenlemelerin nedenini bilir. Soyadı Kanunu ile eşit ve ayrıcalıksız bir toplum oluşturmanın 39 7 D D7..6 amaçlandığını bilir D D7..66 Soyadı Kanunu ile Halkçılık ilkesini ilişkilendirebilir. Milletlerarası Takvim, Ölçü, Saat ve Rakam sistemine geçiş ile 39 7 D D7..67 uluslararası ilişkilerde doğacak aksaklıkların giderilmesinin amaçlandığını kavrar D D7.2. Türkiye Cumhuriyeti nin Dış Politikası 39 7 D D Atatürk dönemi Türk dış politikasının temel ilkelerini ve amaçlarını açıklayabilir. 2

103 Atatürk dönemi dış politikasını tam bağımsızlık, akılcılık, milli 39 7 D D menfaatleri esas alma ilkeleri özelinde değerlendirebilir. Lozan Antlaşması nı Atatürk dönemi Türk dış politikası ilkeleri 39 7 D D7.2.7 ile ilişkilendirebilir. Musul Meselesi nin o günkü ve günümüzde Türk Milleti için 39 7 D D7.2.7 arz ettiği önemi kavrar. Montrö Boğazlar Sözleşmesi, Balkan ve Sadabat Paktı ve Türkiye nin Milletler Cemiyeti ne girişi gibi dış politikada 39 7 D D yaşanan gelişmeleri Atatürk ün dış politika ilkeleri çerçevesinde değerlendirebilir D D7.3. Türkiye Cumhuriyeti nin Dış Politikası Atatürk dönemi sonrası Türk dış politikasının temel ilkelerini ve 39 7 D D amaçlarını açıklayabilir. İkinci Dünya Savaşı ndaki gelişmeleri ve bu savaşın 39 7 D D sonuçlarının Türkiye ye etkilerini analiz edebilir. İkinci Dünya Savaşı nda takip edilen Türk dış politikasını 39 7 D D7.3.7 Türkiye nin milli menfaatleri noktasında değerlendirebilir. Türkiye nin Batılı ülkelerle ilişkilerini ve onların siyasi ve 39 7 D D askeri kurumları içinde yer alma mücadelesini anlar ve bu alanda yaşanan problemleri kavrar. Türkiye nin milli davalarından biri olarak, Kıbrıs ta meydana 39 7 D D gelen gelişmeleri anlar ve bunun Türkiye için önemini bilir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği 3 Şubat 22 UyumHaftası 2 2 Şubat 22 Milli Mücadele: TBMM ye Karşı Ayaklanmalar, Sevr Antlaşması, Milli Mücadele nin Cepheleri; Doğu, Güney ve Batı Cepheleri ve Sonuçları Milli Mücadele: Savaşı Bitiren Antlaşmalar, Mudanya Ateşkes 3 27 Şubat 22 Antlaşması, Lozan Antlaşması Türkiye Cumhuriyeti nin Kuruluşu: Saltanatın Kaldırılması, 4 Mart 22 Cumhuriyetin İlanı, Halifeliğin Kaldırılması, Atatürk ün Cumhuriyetçilik İlkesi Cumhuriyetin Demokratikleşmesi: Halk Fırkası, Terakkiperver Cumhuriyet Fırkası, Serbest Cumhuriyet Fırkası, Demokrat Parti ve 2 Mart 22 Sonrası, Seçme ve Seçilme Hakkının Geliştirilmesi, Atatürk ün Halkçılık ilkesi Cumhuriyetin Laikleşmesi: Yönetimin (Halifeliğin Kaldırılması), Hukukun (Şer i Hukukun ve Mahkemelerin Sona Ermesi ve Yeni 6 9 Mart 22 Hukuk Düzeni, Anayasa ve Yasalarda Değişiklikler) ve Eğitimin Laikleşmesi (Tevhid-i Tedrisat Kanunu), Atatürk ün Laiklik İlkesi Milliyetçilik İlkesi: Milli Devlet, Milli Tarih (Türk Tarih Kurumu), 7 26 Mart 22 Milli Dil (Türk Dil Kurumu), Atatürk ün Milliyetçilik İlkesi 8 28 Mart- Nisan 22 Ara sınav Devletçilik İlkesi: İzmir İktisat Kongresi, Ekonominin 9 9 Nisan 22 Millileştirilmesi, Özel Girişimciliğin Desteklenmesi, Devlet Eliyle Kalkınma, Planlı Ekonomi, Atatürk ün Devletçilik İlkesi İnkılâplara Tepkiler: Şeyh Sait Ayaklanması, İzmir de Atatürk e 6 Nisan 22 Suikast Girişimi, Menemen Olayı Türk Tarihinin Anayasaları ve Özellikleri: 876, 99, 92, 924, 23 Nisan 22 96, 982 Anayasaları ve Özellikleri Eğitim İnkılâbı:Tevhid-i Tedrisat Kanunu, Türk Eğitim Sisteminin 2 3 Nisan 22 Temel Özellikleri, Harf İnkılâbı, Eğitimi Geliştirmek İçin Yapılan Çalışmalar, Halkevleri, Köy Enstitüleri, Üniversite Reformu Toplumsal Alanda Yapınla İnkılâplar: Kıyafet İnkılâbı, Tarikatların 3 7 Mayıs 22 Yasaklanması, Soyadı Kanunu, Milletlerarası Takvim, Ölçü, Rakam Sistemine Geçiş 3

104 Türkiye Cumhuriyeti nin Dış Politikası: Türkiye nin Stratejik 4 4 Mayıs 22 Önemi, Milli Mücadele Döneminde Dış Politika, Atatürk Döneminde Dış Politika Türkiye Cumhuriyeti nin Dış Politikası: Atatürk Sonrasında Dış 2 Mayıs 22 Politika 3 Mayıs-7 Haziran 22 Dönem sonu sınavı -2 Haziran 22 Bütünleme sınavı Değerlendirme Bu dersin değerlendirmesi, kaynak kitap temel alınarak hazırlanacak olan çoktan seçmeli bir ara sınav ve bir dönem sonu sınavı aracılığıyla yapılacaktır. Ara sınavın ortalamaya katkısı % 4dönem sonu sınavının ise % 6 tır. Geçme notu üzerinden 6 tır. - Osmanlı Devleti nde özellikle 789 Fransız İhtilalı ndan sonra sorun olmaya başlayan azınlıklar meselesi devletin yıkılışına kadar sürmüştür. Lozan Barışı nda azınlık sorunu nasıl bir çözüme kavuşturulmuştur? a-azınlıklar her türlü faaliyetlerinde serbesttirler b-azınlıkların bütün ayrıcalıkları kaldırılmıştır c-azınlıklar Birleşmiş Milletlerin korumacılığı altındadır d-azınlıklar insan hakları komisyonunca himaye edilirler e-azınlıklar milli esaslara göre ülke değiştirebilirler 2-Türkiye'de; I. Tanık olmada kadın ve erkeğin eşit olması II. Miras işlemlerinin yeniden düzenlenmesi III. Kadınların seçme ve seçilme hakkını sağlayan ortamın oluşması gibi gelişmeler, aşağıdakilerden hangisinin sonuçları arasındadır? a-kabotaj Kanunu'nun b-takrir-i Sükun Kanunu'nun c-tevhid-i Tedrisat Kanunu'nun d-şapka Kanunu'nun e-türk Medeni Kanunu'nun Örnek Sorular 3- I.Eğitimde ikiliğe son vermek II.Eğitimde çağdaşlaşmak III.Eğitimde laikliği sağlamak Yukarıdaki amaçları gerçekleştirmeye yönelik en önemli ilk inkılâp, aşağıdakilerden hangisidir? a-şer iye ve Evkaf Vekâleti nin kaldırılması b-köy Enstitülerinin açılması c-tekke ve Zaviyelerin kapatılması d-tevhid-i Tedrisat Kanunu nun kabul edilmesi e-üniversitelerin açılması Anayasasında Türkiye halkına.farkı gözetmeksizin vatandaşlık itibariyle Türk denir ifadesi yer almaktadır. Bu tanıma göre aşağıdaki seçeneklerde verilen hangi farkların gözetilmemesi esas alınmıştır? a- Din ve dil b- Dil, din, ırk c- Din ve ırk d- Dil ve ırk e- Dil ve tarih -Türkiye, Boğazlar üzerindeki tam hâkimiyetini hangi antlaşma sonucu kazanmıştır? a-montrö Antlaşması b-lozan Antlaşması c-sevr Antlaşması d-londra Antlaşması e-mudanya Antlaşması Cevap Anahtarı -b, 2-e, 3-d, 4-c, -a 4

105 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi Sabri Zengin, Atatürk İlkeleri ve İnkılâp Tarihi, Taşhan Kitap, Tokat 26. Sorumlu Olunan Sayfalar: Kitabın 4. sayfasından sonuna kadar. - Kemal Atatürk, Nutuk, Cilt: I-III, İstanbul YÖK-Komisyon, Atatürk İlkeleri ve İnkılâp Tarihi, Ankara Komisyon, Türkiye Cumhuriyeti Tarihi I-II, AAM Yay., Ankara 22. İNGİLİZCE II Öğretim Üyesi Öğr.Gör.Oğuzhan SÖNMEZ Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Bu ders sonucu öğrenciler İngilizcenin temel yapılarını kullanarak kendilerini ifade edebileceklerdir. Bu ders öğrencilere İngilizce temel yapılarını başlangıç düzeyde (Beginner / A) vermeyiamaçlar. Konu ve ilgili kazanım 39 D D4.. There is / Thereare 39 D D4.. Evin bölümleri ve eşyaların İngilizce karşılıklarını bilir. 39 D D4..2 There is / are kullanılarak örnek cümle yazar 39 D D4.2. This/that/these ve those yapıları öğretilerek nesnelerin konumuna göre basit sıfatlar kullanarak cümlede kullanma yetisi edinilir. 39 D D4.2.3 This/that/these ve those yapılarını öğrenir 39 D D4.2.4 Bu yapıların nesnelerin konumuna göre ifade edildiğini keşfeder 39 D D4.2. Bu yapıları cümle içinde kullanır 39 D D4.3. Can ve can tmodalverb I 39 D D4.3.6 Can / can tmodalverbler kullanılarak basit cümleler kurabilir 39 D D4.3.7 Kalıbı soru cümlelerinde kullanabilir 39 D D4.3.8 Konu ile ilgili alıştırmaları cevaplayabilir. 39 D D4.4. Can ve can tmodalverb II 39 D D4.4.9 Adverbs( zarf) öğrenimi ile kurdukları cümleleri geliştirirler. 39 D D4.. Can ve can tmodalverb III 39 D D4.. Can ve geniş zaman kullanımlı cümle kurma 39 D D4.6. Writing çalışması 39 D D Bu haftaya kadar işlenen zaman kavramları ile ilgili karşılaştırmalı alıştırmaları cevaplayabilir. 39 D D4.6.2 Kendilerini ifade eden metin oluştururlar. 39 D D4.7. Reading çalışması

106 39 D D4.7.3 Öğrendikleri konuları içeren metinleri okuyup cevaplandırabilir. 39 D D4.8. WAS /WERE,The Simple Past Tense 39 D D4.8.4 Was/were ile basit cümleler kurabilir. 39 D D4.9. The Simple Past Tense 39 D D4.9. Dili geçmiş zamanda (The Simple Past Tense) olumlu cümle kurar. 39 D D4.9.6 Yapıyı olumsuz cümle kalıbında deneyimler 39 D D4.9.7 Soru formlarında cümle kuruluşlarını bilir 39 D D4.. Düzenli/Düzensiz fiiller 39 D D4..8 Öğrendiği fiillerle geçmiş zamanda cümle kurar. 39 D D4.39. Reading çalışması II 39 D D Sımplepast tense kullanılan metni okuyup sorularını cevaplandırır. 39 D D4.2. Sımplepast tense tımeexpressions 39 D D4.2.2 Bu zaman ile kullanılan zaman zarflarını edinir. 39 D D4.4. Sımplepresent tense andsımplepast tense 39 Geniş zaman ve geçmiş zamanı karşılaştıran soruları D D4.4.2 cevaplayabilir. 39 D D Geniş zaman kullanarak son tatilini anlatan metin yazabilir Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 Uyum Haftası Şubat 22 There is / Thereare PY Şubat 22 This/that/these ve those yapıları PY Mart 22 Can ve can tmodalverb I PY4 9-3 Mart 22 Can ve can tmodalverb II PY Mart 22 Can ve can tmodalverb III PY Mart 22 Writing çalışması PY4 28 Mart- Nisan 22 Ara Sınav Nisan 22 Reading çalışması PY Nisan 22 WAS /WERE,The Simple Past Tense PY Nisan 22 The Simple Past Tense PY4 27 Nisan- Mayıs 22 Düzenli/Düzensiz fiiller PY Mayıs 22 Reading, Writting çalışması II PY4 3 - Mayıs 22 Sımplepast tense tımeexpressions PY Mayıs 22 Sımplepresent tense andsımplepast tense PY4 3 Mayıs-7 Haziran 22 Final Sınavı -2 Haziran 22 Bütünleme Sınavı Değerlendirme Budersindeğerlendirmesi,derskaynaklarıilederslerde verilen bilgileresas alınarakhazırlanacakolançoktanseçmelibirvizevebirdefinal sınavı aracılığıyla yapılacaktır.vize sınavının nihai ortalamayakatkısı %4 iken, final sınavınınki %6 olacaktır.dersi geçmek için gereken nihai ortalama, final notunun en az olması kaydıyla, üzerinden6 tır. Dersten başarısız olan öğrenciler, final sınavı ile aynı etkiye sahip olan bütünleme sınavına girebilirler.. A: Do youwear a suittowork? B: No, we suits in theoffice. Which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? Örnek Sorular A )don thavetowear B )towear C )doesn thavetowear D ) has towear E )havetowear 2. It sjo sbirthday. I wantto buy for her but I don tknowwhattoget. Which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? 6

107 A )gloves B )sunglasses C ) a briefcase D ) a present E ) a packback 3. My dad s..is American. Which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? A )language B )nationality C )country D )continent E )region 4. You can. tovancouver Island forthecity. Which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? A) travelabroad B )get a view C )take a ferry D )walkaround E )visit. A: WhenwegotoEgypt,. wevisitthepyramids? B: Yes, of coursewe can. Why not? Which of thefollowingcompletesthedialogueabove? Aşağıdakilerden hangisi yukarıdaki konuşmayı doğru şekilde tamamlar? A ) do B )can t C )are D )don t E ) can Cevap Anahtarı -)a 2-) d 3-) b 4-) c -)e Kaynak Kitap -)EssentialGrammer in Use, Raymond Murphy, 98, Cambridge Yayınları )Advanced Grammar in Use, Raymond Murphy, 98, Cambridge Yayınları Yardımcı Kaynaklar ve Okuma Listesi FTP-6 TEMEL BİLGİ TEKNOLOJİLERİ Öğretim Üyesi Uğur Çiğdem 7

108 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı LAB Bu ders ile öğrencinin, bilişim teknolojilerinin her dalında ihtiyaç duyulan ofis programlarını kullanımı ile ilgili yeterliklerin kazandırılması amaçlanmaktadır. Konu ve ilgili kazanım 39 2 BP 39.2.BP.. Temel Bilişim Kavramaları ve Donanım Elemanları 39 2 BP 39.2.BP.. Bilgisayarı kullanırken dikkat edilmesi gereken sağlık kurallarını bilir 39 2 BP BP..2 Bilgisayarların temizlik ve bakımını bilir 39 2 BP BP..3 Bilişim, bilgisayar gibi temel kavramları bilir 39 2 BP BP..4 Donanım ve yazılım kavramını bilir 39 2 BP 39.2.BP.. Bilgisayar çeşitlerini bilir 39 2 BP BP..6 Bilgisayarlar arasındaki farkları bilir 39 2 BP BP..7 Bilgisayar donanım elemanlarını ve görevlerini bilir 39 2 BP BP..8 Hafıza ölçü birimlerini ve hız birimlerini bilir 39 2 BP BP.2. İşletim Sistemleri 39 2 BP BP.2.9 İşletim sistemlerini ve farklılıklarını bilir 39 2 BP BP.2. İşletim sistemlerinin kurulumunu bilir 39 2 BP BP.2. Donatılar bölümü elemanlarını bilir 39 2 BP BP.2.2 Denetim masası elemanlarını bilir 39 2 BP BP.3. Dosya Yönetimi 39 2 BP BP.3.3 Dosya yönetim sistemlerini bilir 39 2 BP BP.3.4 Donanım elemanlarının kurulmasını ve sürücülerinin tanıtılmasını bilir 39 2 BP BP.3. Klavye tuşlarının görevlerini bilir 39 2 BP BP.4. Ofis Programı Kurulumu ve Kelime İşlemci Programı Menüleri 39 2 BP BP.4.6 Ofis programının kurulumunu yapabilir 39 2 BP BP.4.7 Kelime işlemci programı menülerini ve şeritlerin görevlerini bilir 39 2 BP BP.4.8 Belge işlemlerini bilir 39 2 BP BP.4.9 Belge kaydetme ve açma işlemlerini bilir 39 2 BP BP.4.2 Belgeyi şifreleme ve şifreyi kaldırma işlemlerini bilir 39 2 BP 39.2.BP.. Biçimlendirme ve Paragraf İşlemleri 39 2 BP BP..2 Biçimlendirme işlemlerini bilir 39 2 BP BP..22 Paragraf işlemlerini bilir 39 2 BP BP..23 Stiller bölümünü aktif kullanabilir 39 2 BP BP.6. Word de Tablo İşlemleri 39 2 BP BP.6.24 Tablo ekle, sil ve kalemle çizimleri yapabilir 39 2 BP BP.6.2 Satır ve sütun ekleme ve silme yapabilir 39 2 BP BP.6.26 Tablo tasarımlarını kullanabilir 39 2 BP BP.7. Ekle ve Sayfa Düzeni işlemleri 39 2 BP BP.7.27 Nesne işlemlerini bilir 39 2 BP BP.7.28 Sayfa numarası, maddeleme ve köprü ekler 39 2 BP BP.7.29 Alt ve üst bilgi, denklem ekleyebilir 39 2 BP BP.7.3 Grafik ve SmartArt ekleyebilir 39 2 BP BP.7.3 Sayfa yönlendirme ve sütunlara bölmeyi bilir 39 2 BP BP.7.32 Sayfaya kenarlık ekleyebilir 39 2 BP BP.7.33 Filigran ekleyebilir. Sayfa rengini değiştirebilir 39 2 BP BP.8. Gözden Geçirme, Görünüm ve Yazdırma İşlemleri 8

109 39 2 BP BP.8.34 Yazdırma işlemlerini bilir 39 2 BP BP.8.3 Sayfalara farklı tasarımlar uygulayabilir 39 2 BP BP.8.36 Başvurular menüsü işlemlerini bilir 39 2 BP BP.8.37 Belge hatalarını düzeltebilir 39 2 BP BP.8.38 Farklı sayfa görünümlerini kullanabilir 39 2 BP BP.9. Elektronik Tablolamaya Giriş ve Menüler 39 2 BP BP.9.39 Menüleri ve şeritlerin görevini bilir 39 2 BP BP.9.4 Çalışma alanı ve veri girişi işlemlerini bilir 39 2 BP BP.9.4 Biçimlendirme işlemlerini bilir 39 2 BP BP.9.42 Sayfa tasarımlarını bilir 39 2 BP BP.9.43 Hücre, satır ve sütun büyüklüklerini ayarlayabilir 39 2 BP BP.9.44 Grafik ve Şekiller çizebilir 39 2 BP BP.9.4 Yazdırma işlemlerini bilir 39 2 BP 39.2.BP.. Excel de Tablo Çizimi 39 2 BP BP..46 Tablo çizebilir 39 2 BP BP..47 Tablo tasarımlarını uygulayabilir 39 2 BP BP..48 Satır ve sütun ekleyebilir veya silebilir 39 2 BP BP..49 Veri analizi işlemlerini bilir 39 2 BP 39.2.BP.. Hücre içi hizalama ve yönlendirme ayarlarını bilir 39 2 BP 39.2.BP.. Farklı sayı ve tarih yazımlarını ve finansal yazımları bilir 39 2 BP BP..2 Verileri sıralayabilir ve filtreleyebilir 39 2 BP BP..3 Sayfa ve hücreleri koruma yöntemlerini bilir 39 2 BP 39.2.BP.. Formüller 39 2 BP BP..4 Formül yazım kurallarını bilir 39 2 BP 39.2.BP.. Fonksiyon kullanmadan formül yazabilir 39 2 BP BP..6 Fonksiyon kullanarak formül yazabilir 39 2 BP BP..7 Mantıksal ve matematiksel fonksiyonları bilir 39 2 BP BP..8 Bazı önemli finansal fonksiyonları bilir 39 2 BP BP..9 Tarih-saat fonksiyonlarını bilir 39 2 BP BP..6 Makrolar ve özelleştirme işlemlerini bilir 39 2 BP BP.2. Sunu Hazırlama Programı 39 2 BP BP.2.6 Çalışma alanı ve menüleri bilir 39 2 BP BP.2.62 Slayt işlemlerini bilir 39 2 BP BP.2.63 İyi bir tasarım yapabilir 39 2 BP BP.2.64 Geçişler menüsü ayarlarını bilir 39 2 BP BP.2.6 Animasyonlar menüsü uygulamalarını bilir 39 2 BP BP.2.66 Slayt gösterisi menüsündeki uygulamaları bilir 39 2 BP BP.2.67 Slayt nesnelerini ve yazdırma ayarlarını bilir 39 2 BP BP.2.68 Özgün bir slayt hazırlayabilir 39 2 BP BP.3. İnternet ve Elektronik Posta 39 2 BP BP.3.69 İnternet terimlerini ve internet tarihçesini bilir 39 2 BP BP.3.7 İnternet kullanım alanlarını bilir 39 2 BP BP.3.7 İnternete bağlantı yöntemlerini bilir 39 2 BP BP.3.72 İnternet güvenlik ayarlarını bilir 39 2 BP BP.3.73 İnternet adres yapısını ve kısaltmaların görevlerini bilir 39 2 BP BP.3.74 İletişim kurallarını (protokoller) bilir 39 2 BP BP.3.7 Tarayıcı programları bilir 39 2 BP BP.3.76 Arama motorlarını bilir 39 2 BP BP.3.77 Elektronik posta adreslerinin yapısını bilir 39 2 BP BP.3.78 E-posta gönderme ve almayı bilir 39 2 BP BP.3.79 E-posta virüs bulaşma uyarılarını bilir Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 Uyum Haftası Şubat 22 Temel Bilişim Kavramaları PY PY2 PY Şubat 22 İşletim Sistemleri PY2 PY Mart 22 Dosya Yönetimi PY2 PY4 9

110 9-3 Mart 22 Ofis Programı Kurulumu ve Kelime İşlemci Programı Menüleri PY7 PY Mart 22 Biçimlendirme ve Paragraf İşlemleri PY7 PY Mart 22 Word de Tablo İşlemleri PY7 PY 28 Mart- Nisan 22 Ara Sınav 8 6- Nisan 22 Ekle ve Sayfa Düzeni İşlemleri PY7 PY Nisan 22 Gözden Geçirme, Görünüm ve Yazdırma İşlemleri PY PY7 PY Nisan 22 Elektronik Tablolamaya Giriş ve Menüler PY PY7 PY4 27 Nisan- Mayıs 22 Excel de Tablo Çizimi PY PY7 PY Mayıs 22 Formüller PY6 3 - Mayıs 22 Sunu Hazırlama Programı PY Mayıs 22 İnternet ve Elektronik Posta PY PY6 3 Mayıs-7 Haziran 22 Yarıyıl Sonu Sınav -2 Haziran 22 Bütünleme Sınavı Değerlendirme Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas alınarak hazırlanacak olan bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. -) Aşağıdaki e- posta isimlerinden hangisi doğru yazılmıştır? a) b) c) d) e) 2-) Kelimeler arasında boşluk bırakmak için kullanılan tuş hangisidir? a) Backspace b) Enter c) Shift d) Spacebar e) CapsLock Örnek Sorular 3-) İnternet adres yapısı ile ilgili aşağıdaki ifadelerden hangisi yanlıştır? a) com iletişim siteleri b) gov - devlet siteleri c) mil askeri siteler d) org vakıflar e) edu eğitim siteleri 4-) Aşağıdakilerden hangisi USB girişi ile bilgisayara bağlanamaz? a. Fare b. Ekran c. Web cam d. Yazıcı e. Tarayıcı -) PowerPoint dosyasının uzantısı aşağıdakilerden hangisidir? a) xlsx b)docx c)pptx d)jpgx e) gif Cevap Anahtarı Kaynak Kitap -)d, 2-) d, 3-) a, 4-) b, -) c -) Ofis Programları, Ozan Kara 2-) Temel Bilgi Teknolojileri I, II, T.C. ANADOLU ÜNİVERSİTESİ YAYINI NO: ) Bilişim Teknolojileri, Hüseyin Uzunboylu, Pegem Akademik Yayıncılık

111 D e Okul Program Ders Konu Kazanım Kodu -) MEGEP Modül, Ders Sunuları, biltek.info 2-) Bilişim Teknolojileri, Doç. Dr. Serhat Bahadır Kert, Nobel Akademik Yayıncılık Yardımcı Kaynaklar ve Okuma Listesi FTP-4 FİZYOTERAPİDE KLİNİK KAVRAMLAR ÖğretimÜyesi Oda Numarası E-posta DersZamanı Derslik DersinAmacı Fizyoterapidekullanılanklinikkavramlarıvekliniktesıkkarşılaşılanproblemleritanımlamak. Konuveilgilikazanım 39 7 FTP FTP4.. Fizyoterapi-rehabilitasyonkavramı,çeşitleri 39 7 FTP FTP4.. Fizyoterapiverehabilitasyonkapsamındakidersleriöğrenirvekullanıl ankavrambaşlıklarınıbilir FTP FTP4.2. Egzersizçeşitlerivesınıfalnadırması 39 7 FTP FTP4.2.2 Egzersiztanımınıöğrenir FTP FTP4.2.3 Egzersiztürlerinibilir FTP FTP4.3. Nörolojikhastalıklardaklinikkavramlar 39 7 FTP FTP4.3.4 Nörolojikhastalıklarıgenelkapsamlarıylaöğrenir FTP FTP4.4. Nörolojikhastalıklardaklinik kavramlar FTP FTP4.4. Nörolojkhastalıklarıbirbirindenayırteder FTP FTP4.4.6 Nörolojikrehabilitasyondakullanılanklinikkavramlarıbilir FTP FTP4.. Ortopedikhastalıklardaklinikkavramlar 39 7 FTP FTP4..7 Ortopedikhastalıklarıgenelkapsamlarıylaöğrenir FTP FTP4.6. Ortopedikhastalıklardaklinik kavramlar FTP FTP4.6.8 Ortopedikhastalıklarıbirbirindenayırteder FTP FTP4.6.9 Ortopedikhastalıklardakullanılanklinikkavramlarıbilir FTP FTP4.7. Sporveegzersizkavramları 39 7 FTP FTP4.7. Spordaegzersiztanımlamasınıyapabilir FTP FTP4.7. Sporveegzersizdekullanılanklinikkavramlarıbilir FTP FTP4.8. Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) 39 7 FTP FTP4.8.2 Romatoidartritveosteoartrithastalıklarınıöğrenir.

112 39 7 FTP FTP4.8.3 Romatoidartritveosteoartrithastalıklarındakullanılanklinikkavraml arıbilir FTP FTP4.9. Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) 39 7 FTP FTP4.9.4 Ankilozonspondilithastalığınıtanımlayabilir FTP FTP4.9. Ankşlozonspondilithastalıpındakullanılanklinikkavramlarıbilir FTP FTP4.9.6 Osteoporozhastalığınıtanımlayabilir FTP FTP4.9.7 Osteoporozhastalığındakullanılankilinikkavramlarıbilir FTP FTP4.. Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) 39 7 FTP FTP4..8 Mekanik bel ağrısınıtanımlayabilir.diskhernisinitanımlayabilir FTP FTP4..9 Mekanik bel ağrısındakullanılankavramlarıbilir FTP FTP4..2 Disk hernisinitanımlayabilir FTP FTP4..2 Disk hernisindekullanılanklinikkavramalarıbilir FTP FTP4.. Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) 39 7 FTP FTP4..22 Omuz-el yaralanmalarınıöğrenir FTP FTP4..23 Omuz -el yaralanmalarındakullanılanklinikkavramlarıbilir FTP FTP4.2. Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) 39 7 FTP FTP Diz -ayakbileğiyaralanmalarınıtanımlayabilir FTP FTP4.2.2 Dizayakbileğiyaralanmalarındakullanılanklinikkavramlarıbilir FTP FTP4.3. Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) 39 7 FTP FTP Fizyoterapidesıklıklakarşılaşılanhastalıklardakullanılanklinikkavra mlarahakimdir. 2

113 Hafta-Tarih DersKonuları İlgili Program Yeterliği -4Şubat 22 UyumHaftası 2 7-2Şubat 22 Fizyoterapi- rehabilitasyon kavramı, çeşitleri PY PY Şubat22 Egzersiz çeşitleri, sınıflandırılması PY6 PY Mart 22 Nörolojik hastalıklarda klinik kavramlar PY4 PY 9-3 Mart 22 Nörolojik hastalıklarda klinik kavramlar PY4 PY Mart 22 Ortopedik hastalıklarda klinik kavramlar PY Mart 22 Ortopedik hastalıklarda klinik kavramlar PY3 28 Mart- Nisan 22 Ara Sınav 8 6- Nisan 22 Spor ve egzersiz kavramları PY Nisan 22 Fizyoterapide sıklıkla karşılaşılan hastalıklar ve yaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayak bileği yaralanmaları) Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, 2-24 Nisan 22 mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, 27 Nisan-Mayıs22 mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) İzyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, 4-8Mayıs22 mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, -Mayıs22 mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) Fizyoterapidesıklıklakarşılaşılanhastalıklarveyaralanmalar (Romatoidartrit, osteoartrit, ankilozanspondilit, osteoporoz, 8-22Mayıs 22 mekanik bel ağrısı, disk hernisi, omuz-el yaralanmaları, dizayakbileğiyaralanmaları) 3 Mayıs-7Haziran22 DönemSonuSınavı -2 Haziran 22 BütünlemeSınavı Değerlendirme Örneksorular PY2 PY PY2 PY PY2 PY PY2 PY PY2 PY PY2 PY Bu dersindeğerlendirmesi, kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır..)aşağıdakilerdenhangisikırıktipleriarasındadeğildir? a.) Parçalıkırık b.) Yeşilağaçkırığı c.) Streskırığı d.) Zıplamakırığı 2.) Aşağıdakilerdenhangisiprogresifmsshastalıklarıarasındadeğildir? a.) Als b.) Alzaymırhastalığı c.) Huntington hastalığı d.) Cp (cerebral palsy ) 3.) Aşağıdakilerdenhangisiyanlıştır? a.) İzotonikkontraksiyondaizometrik yada eksentrik kas hareketivardır. b.) İzometrikkontraksiyondagözlegörülebilirbireklemhareketiyoktur. c.) İzokinetikkontraksiyonsabithızdakikonsantrik yada eksantrik kas hareketidir. d.) Motor ünitebir motor nöronveinerveettiğikaslardanoluşur. 3

114 Örneksorular. Aşağıdakilerdenhangisininenuyguntanımıdır? a) Bireyiniçerisindeyaşadığıkültüründeğerlerinikazanmasüreci b) Bireyinçevresiyleetkileşimindemeydanagelendeğişme c) Yenivekalıcıbilgilerinedinilmesiiçinyararlanılanyöntem d) Tekrarya da yaşantılaryoluylameydanagelennispetenkalıcıdavranışdeğişikliği e) İstenilendavranışdeğişikliğinioluşturmakamacıylabireyingösterdiğibilinçliça ba 2. Anksiyeteilebaşetmedeuygulanacakgirişimlerleilgiliaşağıdaverilenlerdenhangisi yanlıştır? a) Hastanınanksiyetedüzeyibelirlenmelidir (hafif, orta, şiddetli, panik) b) Hasta yalnızbırakılmamalı, c) Çevreseluyaranlarattırılmalıdır d) Hastanınbaşetmemekanizmalarıbelirlenmeliveuygunbaşetmeyöntemikullanı mısağlanmalı 3. Çocuklarda cinsel istismar konusu ile ilgili aşağıdakilerden hangisi yanlıştır? a) Çocuklar bu konuda genellikle yalan söylemezler. İlk kural çocuğa inanmak olmalıdır. b) İstismarcılar genellikle yaşlı ve yabancı erkeklerle sokaktaki serserilerdir c) Mağdurlar her sosyo-ekonomik ve her sosyo-kültürel gruptan gelen kız ve erkek çocuklar olabilir d) Olayın olduğu yer genellikle ev, okul gibi çocuğun içinde bulunduğu yakın çevresidir CevapAnahtarı -b 2-d 3-c 4-b KaynakKitap YardımcıKaynaklarve Okuma Listesi C. Algun, FizyoterapiveRehabilitasyon, Nobel TıpKitabevi, 2 4

115 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu FTP-8 FİZİK TEDAVİ YÖNTEMİ II Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Terapatik, kuvvetlendirici ve ağrı kesici amaçlı elektroterapi yöntemlerini öğretmek. Konu ve ilgili kazanım 39 7 FTP FTP8.. Elektroterapinin genel etkileri 39 7 FTP FTP8.. Elektroterapiajanlarıı tanımlar FTP FTP8..2 Elektroterapinin genel ve lokal etkilerini öğrenir FTP FTP8.2. Elektroterapi çeşitleri 39 7 FTP FTP8.2.3 Elektroterapi çeşitlerini öğrenir FTP FTP8.2.4 Elektrotroterapi uygulama kriterlerini öğrenir FTP FTP8.3. Ultrason 39 7 FTP FTP8.3. Ultrason ajanını tanır ve uygulama kriterlerini bilir FTP FTP8.4. Ultrason 39 7 FTP FTP8.4.6 Ultrason uygulamasının endikasyonlarını bilir FTP FTP8.4.7 Ultrason uygulamasının kontraendikasyonlarını bilir FTP FTP8.. Tens 39 7 FTP FTP8..8 Tens ajanını tanır ve uygulama kriterlerini öğrenir FTP FTP8.6. Tens 39 7 FTP FTP8.6.9 Tens uygulamasının endikasyonlarını bilir FTP FTP8.6. Tens uygulamasının kontraendikasyonlarını bilir FTP FTP8.6. Tens uygulamasını bilir FTP FTP8.7. Enterfaransiyel akım 39 7 FTP FTP8.7.2 Enterfaransiyel akımları tanımlar 39 7 FTP FTP8.7.3 Enterfaransiyel akımların endikasyonlarınıkontraendikasyonlarını bilir ve uygulamasını yapabilir FTP FTP8.8. Diadinamik akım 39 7 FTP FTP8.8.4 Diadinamik akımları tanımlar. Diadinamik akımların endikasyonlarınıkontraendikasyonlarını 39 7 FTP FTP8.8. bilir ve uygulamasını uygun hastada yapabilir FTP FTP8.9. Russian akım 39 7 FTP FTP8.9.6 Russian akımları tanımlayabilir FTP FTP8.. Russian akım Russian akımların endikasyonlarınıkontraendikasyonlarını 39 7 FTP FTP8..7 bilir ve uygun hastada uygulama yapabilir FTP FTP8.. Mikroakım

116 39 7 FTP FTP8..8 Mikroakımları tanımlar. Mikroakımlarınendikasyonlarınıkontraendikasyonlarını bilir 39 7 FTP FTP8..9 ve uygun hastada uygulama yapabilir FTP FTP8.2. ESWT 39 7 FTP FTP8.2.2 ESWT ajanını tanımlar. ESWT ajanın endikasyonlarınıkontraendikasyonlarını bilir ve 39 7 FTP FTP8.2.2 uygun olan hastada uygulamasını yapabilir FTP FTP8.3. Diğer yöntemler Akupuntur, hacamat, sülük vb. gibialternatif tıp yöntemleri ilr 39 7 FTP FTP ilgili genel bir bilgiye olur. Alternatif tıp yöntemlerinin sağlık sektöründeki yerini ve 39 7 FTP FTP önemini kavrar. Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 Uyum haftası PY Şubat 22 Elektroterapinin genel etkileri PY3PY4-PY Şubat 22 Elektroterapi çeşitleri PY3PY4-PY Mart 22 Ultrason PY4-PY 9-3 Mart 22 Ultrason PY4-PY Mart 22 TENS PY3PY4-PY Mart 22 TENS PY3PY4-PY 28 Mart- Nisan 22 Ara sınav 8 6- Nisan 22 Enterfaransiyel Akım PY3PY4-PY Nisan 22 Diadinamik Akım PY3PY4-PY 2-24 Nisan 22 Russian Akım PY3PY4-PY 27 Nisan- Mayıs 22 Russian Akım PY3-PY Mayıs 22 Mikroakım PY3-PY 3 - Mayıs 22 ESWT PY3PY4-PY Mayıs 22 Diğer Yöntemler PY3PY4-PY 3 Mayıs-7 Haziran 22 Yarıyıl sonu sınavları -2 Haziran 22 Bütünleme sınavları Bu dersindeğerlendirmesi, Değerlendirme kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıylayapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır. Örnek Sorular.) Diadinamik akımlarla ilgili aşağıdakilerden hangisi yanlıştır? a.)difazfikse uygulamasında hasta iğnelenme hisseder. b.) Monofazfikse ağrılı spazm durumlarında kullanılır. c.) Kurt periyod iki MF akımın birbirini izlemesidir. d.) Ritmsenkop kas ve sinir stümülasyonunda kullanılır. 2.) Rus akımı ile ilgili aşağıdaki bilgilerden hangisi yanlıştır? a.) Sporcularda ve postoperatif dönemde hastalarda kas kuvvetinin arttırılması amacıyla kullanılır. b.) Dinlenme süresi ve uygulama süresi eşittir. c.) Bir seansta - kontraksiyon yaptırılır. d.) Ağrı tolerasyonu iyidir. 3.)Şok dalga tedavisi ile ilgili aşağıda verilen bilgilerden hangisi doğrudur? a.) RESWT tek bir noktaya odaklanır. 6

117 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu b.) Derin bölgelerin tedavisinde Eswt kullanılır. c.) Şok dalgalarının tek bir türü vardır. d.) Odaklanan şok dalga tedavisi RESWT olarak tanımlanır. 4.) Şok dalga tedavisi ile ilgili aşağıdakilerden hangisi yanlıştır? a.) En sık gecikmiş kırık kaynaması ve tendinopatilerde kullanılmaktadır. b.) Kemik doku üzerine yapılan tedavilerde yüksek enerjili ESWT kullanılmaktadır. c.) Düşük ve orta enerjili şok dalgaları uygulanırken en çok önerilen yöntem klinik odaklanmadır. d.) Spastisite durumunda kullanımı kontraendikedir,.)elektroterapinin başarılı olması aşağıdakilerden hangisine bağlı değildir? a.)doğru aletin seçimine b.)uygun ve etkili tedavinin seçimine c.)doğru eklem açısına d.)sonuçların doğru değerlendirilmesini Cevap Anahtarı.C 2.B. 3.A. 4.D..C Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi E. Yakut, Kanıta Dayalı Elektroterapi, Pelikan Yayınevi, 22 H. Kayıhan, Isı Işık ders notları FTP-8 RTEZ-PROTEZ ve YARDIMCI CİHAZLAR Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Ortopedik hastalıkları, fizyoterapi ile ilişkisini ve fizyoterapide kullanılan yardımcı araçları k. Konu ve ilgili kazanım 39 7 FTP FTP8.. Ortez ve Proteze giriş Temel Kavramlar 7

118 39 7 FTP FTP8.. Öğrenciler ortez-protez tanımını öğrenir FTP FTP8..2 Amputasyon seviyelerini öğrenir FTP FTP8..3 Ortez ve protez endikasyonlarını öğrenir FTP FTP8..4 Ortez-protez kullanma nedenlerini öğrenir FTP FTP8.2. Ön ayak hastalıkları 39 7 FTP FTP8.2. Öğrenciler ön ayak anatomisi ve biyomekaniğini öğrenir FTP FTP8.2.6 Ön ayak hastalıklarını öğrenir FTP FTP8.2.7 Kullanılacak ortezler hakkında bilgi sahibi olur FTP FTP8.3. Kısa yürüme ortezleri 39 7 FTP FTP8.3.8 Öğrenciler diz altı anatomisi ve biyomekaniğini öğrenir FTP FTP8.3.9 Diz altı hastalıklarını öğrenir FTP FTP8.3. Kullanılacak ortezler hakkında bilgi sahibi olur FTP FTP8.4. Uzun yürüme ortezleri 39 7 FTP FTP8.4. Öğrenciler diz üstü anatomisi ve biyomekaniğini öğrenir FTP FTP8.4.2 Diz üstü hastalıklarını öğrenir FTP FTP8.4.3 Kullanılacak ortezler hakkında bilgi sahibi olur FTP FTP8.. Bel kemerli uzun yürüme ortezleri 39 7 FTP FTP8..4 Öğrenciler kalça ve bel anatomisi ve biyomekaniğini öğrenir FTP FTP8.. Kalça ve bel hastalıklarını öğrenir FTP FTP8..6 Kullanılacak ortezler hakkında bilgi sahibi olur FTP FTP8.6. Gövde ortezleri 39 7 FTP FTP8.6.7 Öğrenciler gövde anatomisi ve biyomekaniğini öğrenir FTP FTP8.6.8 Gövde hastalıklarını öğrenir FTP FTP8.6.9 Kullanılacak ortezler hakkında bilgi sahibi olur FTP FTP8.7. Hastalıklara göre ortez uygulamaları 39 7 FTP8 7 Öğrenciler genel olarak kullanılacak ortezlerin hastalılara göre FTP8.7.2 ayırt etmesini sağlar FTP FTP8.8. Üst ekstremite protezleri 39 7 FTP FTP8.8.2 Öğrenciler üst ekstremite anatomi ve biyomekaniği öğrenir FTP FTP Üst ekstremiteamputasyon seviyelerini öğrenir FTP FTP Kulanılacak protez ve protez parçalarını öğrenir FTP FTP8.9. Alt ekstremite protezleri 39 7 FTP FTP Öğrenciler altekstremite anatomi ve biyomekaniği öğrenir FTP FTP8.9.2 Alt ekstremiteamputasyon seviyelerini öğrenir FTP FTP Kulanılacak protez ve protez parçalarını öğrenir FTP FTP8.. El protezleri 39 7 FTP FTP8..27 Öğrenciler el-el bileği anatomisi ve biyomekaniğini öğrenir FTP FTP8..28 El-el bileği hastalıklarını öğrenir FTP FTP8..29 Kullanılacak protez ve protez parçalarını öğrenir FTP FTP8.. Ayak protezleri 39 7 FTP FTP8..3 Öğrenciler ayak anatomisi ve biyomekaniğini öğrenir FTP FTP8..3 Ayak hastalıklarını öğrenir FTP FTP8..32 Kullanılacak protez ve protez parçalarını öğrenir FTP FTP8.2. Ortez uygulanışı 39 7 FTP FTP Öğrenciler ortez yapımı veuygulamasını görsel olarak öğrenir 39 7 FTP FTP8.3. Protezlerin uygulanışı 39 7 FTP FTP Öğrenciler protez yapımı veuygulamasını görsel olarak öğrenir Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 UyumHaftası Şubat 22 Ortez ve Proteze giriş Temel Kavramlar PY Şubat 22 Ön ayak hastalıkları PY3-PY Mart 22 Kısa yürüme ortezleri PY2-PY3-PY4 8

119 9-3 Mart 22 Uzun yürüme ortezleri PY2-PY3-PY Mart 22 Bel kemerli uzun yürüme ortezleri PY2-PY3-PY Mart 22 Gövde ortezleri PY2-PY3-PY4 28 Mart- Nisan 22 Ara sınav 8 6- Nisan 22 Hastalıklara göre ortez uygulamaları PY2-PY3-PY Nisan 22 Üst ekstremite protezleri PY2-PY3-PY Nisan 22 Alt ekstremite protezleri PY2-PY3-PY4 27 Nisan- Mayıs 22 El protezleri PY2-PY3-PY Mayıs 22 Ayak protezleri PY2-PY3-PY4 3 - Mayıs 22 Üst ve Alt ekstremite protezleri PY2-PY3-PY Mayıs 22 Ortez ve Protezlerin uygulanışı PY3-PY4-PY7 3 Mayıs -7 Haziran 22 Yarıyıl sonu sınavları -2 Haziran 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. ) Post-op dönemde aşağıdakilerden hangisine dikkat edilmelidir? a) Ödem b) endurans c) hassasiyet d) hepsi Örnek Sorular 2) Gözleme dayalı anaizde yürüme alanı kaç cm dir? a) 2-4 b) 8- c) -3 d) 7-9 3) Aşagıdakilerden hangisi yürümenin ön koşullarından değildir? a) Şok absorbsiyonu b) ilerleme c) amortisör d) denge Cevap Anahtarı ) d 2) b 3) c Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi Şener, Gül ;Erbahçeci, Fatih; Protezler; Hipokrat; 2 Alsancak,Serap ; Ortez ; Hatiboğlu ; Ortopedik Hazır ve Ismarlama Protez Ortez Teknik El KitabıHazırlayan: Doç. Dr. Özlem Güven Ülger, Mustafa GültekinT.C. Aile ve Sosyal Politikalar Bakanlığı FTP-2 SPOR VE EGZERSİZ FİZYOLOJİSİ Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Bu derste öğrencilerin, egzersizin kardiorespiratuar, endokrin ve nöromusküler sistem, fiziksel uygunluk programları ve toparlanma üzerindeki fizyolojik etkileri ile ilgili temel bilgiler edinmeleri, fiziksel uygunluğun değerlendirilmesi, fiziksel uygunluk ile ilgili egzersiz programlarını planlayabilme ve uygulayabilme 9

120 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu becerilerinin kazandırılması amaçlanmaktadır. Konu ve ilgili kazanım 39 7 FTP FTP2.. Egzersizin kardiovasküler sistem üzerine etkisi 39 7 FTP FTP2.. Kalbin yapısını açıklar. Kalbin fonksiyonunu kavrar FTP FTP2..2 Büyük dolaşımı açıklar. Küçük dolaşımı açıklar FTP FTP2..3 Egzersizin dolaşım sistemi üzerine etkilerini açıklar FTP FTP2.2. Kardiovasküler regülasyon ve entegrasyon 39 7 FTP FTP2.2.4 Egzersiz öncesi kardiovasküler durumu tanımlar FTP FTP2.2. Egzersizin kardiovaküler sisteme akut-kronik etkisini tanımlar FTP FTP2.3. Egzersizin solunum sistemi üzerine etkisi 39 7 FTP FTP2.3.6 Solunum sistemini oluşturan organları tanır 39 7 FTP FTP2.3.7 Soluk alıp verme mekanizmasını açıklar FTP FTP2.3.8 Akciğer hacim ve kapasitelerini tanımlar 39 7 FTP FTP2.3.9 Egzersizin solunum sistemi üzerine etkilerini açıklar 39 7 FTP FTP2.4. Egzersizin nöromusküler sistem üzerine etkisi 39 7 FTP FTP2.4. Kasların yapısını, göreveri ve özelliklerini açıklar FTP FTP2.4. Kas lif tiplerini sınıflandırır. Kas kasılmalarını açıklar. Sinir hücresini tanımlar. Sinir sisteminin bölümlerini ve 39 7 FTP FTP2.4.2 fonksiyonlarını tanımlar. Egzersizin nöromusküler sistem üzerindeki akut-kronik etkisini 39 7 FTP FTP2.4.3 açıklar FTP FTP2.. İstirahatte ve fiziksel aktivitede enerji harcaması 39 7 FTP FTP2..4 Enerji kavramlarını açıklar,enerji sistemlerini açıklar. Egzersiz ve istirahat sırasında kullanılan enerji sistemlerini 39 7 FTP FTP2.. karşılaştırır 39 7 FTP FTP2..6 Egzersiz sonrasında toparlanma süreçlerini açıklar 39 7 FTP FTP2.6. Egzersizin endokrin sistem üzerine etkisi ve yorgunluk 39 7 FTP FTP2.6.7 Hormonları tanımlar 39 7 FTP FTP2.6.8 Hormon sisteminde yer alan organların yapılarını açıklar FTP FTP2.6.9 Hormonların egzersizle ilişkisini açıklar FTP FTP2.7. Egzersiz sonrası toparlanma 39 7 FTP FTP2.7.2 Egzersizde kullanılan enerji sistemlerini tanımlar FTP FTP2.7.2 Enerji depo sistemini ve egzersiz sonrası depo edilmesini açılar FTP FTP2.8. Fiziksel uygunluğun tanımlanması, kardiorespiratuar uygunluk 39 7 FTP FTP Kişiye göre egzersiz sistemini bilir FTP FTP Kişiye göre egzersiz reçetesi hazırlamayı bilir. Kardiorespiratuar uygunluğun değerlendirilmesi ( Pratik 39 7 FTP FTP2.9. uygulama ) Kardiorespiratuar sistemin egzersize uygunluğunu 39 7 FTP FTP değerlendirir. Güç,kuvvet ve kassal uygunluğun değerlendirilmesi ( pratik 39 7 FTP FTP2.. uygulama) 39 7 FTP2 2 Güç,kuvvet ve kassal uygunluğun egzersize uygunluğunu 39.7.FTP2..2 değerlendirir. Güç, kuvvet ve kassalendurans ile ilgili egzersiz programlarının 39 7 FTP FTP2.. oluşturulması ( pratik uygulama ) 39 7 FTP2 26 Güç, kuvvet ve kassalendurans ile ilgili egzersiz programlarının 39.7.FTP2..26 oluşturur Dirençli eğitim programlarının planlanması 39 7 FTP FTP2.2.,esnekliğindeğerlendirilmesi ve esneklik programlarının 2

121 oluşturulması ( pratik uygulama) 39 7 FTP Dirençli eğitim programlarının planlanması 39.7.FTP2.2.27,esnekliğindeğerlendirilmesi ve esneklik programlarının oluşturur. Egzersiz reçetelerinin oluşturulması ve yorumlanması ( pratik 39 7 FTP FTP2.3. uygulama) 39 7 FTP FTP Egzersiz reçetelerinin oluşturulması ve yorumlar. Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 Uyum haftası PY Şubat 22 Egzersizin kardiovasküler sistem üzerine etkisi PY2-PY3-PY Şubat 22 Kardiovasküler regülasyon ve entegrasyon PY2-PY3-PY Mart 22 Egzersizin solunum sistemi üzerine etkisi PY2-PY3-PY4 9-3 Mart 22 Egzersizin nöromusküler sistem üzerine etkisi PY2-PY3-PY Mart 22 İstirahatte ve fiziksel aktivitede enerji harcaması PY2-PY3-PY Mart 22 Egzersizin endokrin sistem üzerine etkisi ve yorgunluk PY2-PY3-PY4 28 Mart- Nisan 22 Ara sınav 8 6- Nisan 22 Egzersiz sonrası toparlanma PY2-PY3-PY Nisan 22 Fiziksel uygunluğun tanımlanması, kardiorespiratuar uygunluk PY2-PY3-PY Nisan 22 Kardiorespiratuar uygunluğun değerlendirilmesi ( Pratik uygulama ) PY2-PY3-PY4 27 Nisan- Mayıs 22 Güç,kuvvet ve kassal uygunluğun değerlendirilmesi ( pratik uygulama) PY2-PY3-PY Mayıs 22 Güç, kuvvet ve kassalendurans ile ilgili egzersiz programlarının oluşturulması ( pratik uygulama ) PY2-PY3-PY4 3 - Mayıs 22 Dirençli eğitim programlarının planlanması,esnekliğ değerlendirilmesi ve esneklik programlarının oluşturulması ( PY2-PY3-PY4 pratik uygulama) Mayıs 22 Egzersiz reçetelerinin oluşturulması ve yorumlanması ( pratik uygulama) PY2-PY3-PY4 3 Mayıs-7 Haziran 22 Yarıyıl sonu sınavları -2 Haziran 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan D/Y bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. - Dokuların besleenmesi ve homeostezis için kan akımı gereklidir. Örnek Sorular 2- Venlerde dolaşan kan sol atriuma gelir. 3- Sağ atriuma gelen kan tricüspik kapak ile sağ ventriküle açılır Cevap Anahtarı - D 2- Y 3- D Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi W.McArdle,F. Katch, V. Katch ( eds ) ( 997 ) Exercisephysiology Williams Wilkinscompany UK. 2. Akgün N.( 986 ) Egzersiz fizyolojisi Ege Üniversitesi Basımevi İzmir. 3. Tiryaki Sönmez G.( 22 ) Egzersiz ve Spor Fizyolojisi Ata ofset matbacılık Özer K.(2) Fiziksel uygunluk Nobel yayınevi.ankara. Günay M.,Cicioğlu İ.( 2 ) Spor Fizyolojisi Baran Ofset Ankara. 6. Heyward V. H.( 997 ) Advanced FitnessAssesmentExercisePrescription Human Kinetics USA. 2

122 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu FTP-2 TIBBİ DÖKÜMANTASYON Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Tıbbi dökümantasyon ile ilgili genel kavramlar, tıbbi doküman ve dökümantasyonun tarihçesi, tıbbi dökümanlarıntekik özellikleri, çeşitleri, önemi bilgi ve belge yönetimi, bilgi ve belge hizmeti sunan kurumlar, bilgi kaynaklarını sınıflandırma sistemleri vb. konulara yönelik temel bilgilerin verilmesi amaçlanmaktadır. Konu ve ilgili kazanım 39 7 FTP FTP2.. Tıbbi dökümantasyona giriş 39 7 FTP FTP2.. Tıbbi dokümanların önemini açıklayabilir FTP FTP2.2. Tıbbi dökümantasyona yönelik genel kavramlar 39 7 FTP FTP2.2.2 Tıbbi dokümanlarla ilgili temel tanım ve kavramları tanımlar FTP FTP2.3. Tıbbi doküman ve dökümantasyonun tarihçesi-i 39 7 FTP FTP2.3.3 Tıbbi dokümanların tarihi gelişimini açıklayabilir FTP FTP2.4. Tıbbi doküman ve dökümantasyonun tarihçesi-ii 39 7 FTP FTP2.4.4 Tıbbi dokümanların tarihi gelişimini açıklayabilir 39 7 FTP-2 4 Tıbbi dokümantasyon gelişim süreci ile ilgili tarihsel donanıma 39.7.FTP2.4. sahip olur 39 7 FTP-2 Tıbbi dökümantasyonunuluslar arası kullanımı ve Türkiye de 39.7.FTP2.. sağlık kayıtları 39 7 FTP FTP2..6 Uluslararası ve ülkemizde kullanılma şekillerini öğrenir FTP FTP2.6. Tıbbi dökümantasyon çeşitleri 39 7 FTP FTP2.6.7 Doküman çeşitlerini öğrenir FTP FTP2.6.8 Arşiv sistemini oluşturur FTP FTP2.7. Tıbbi dökümanların taşıması gereken özellikler 39 7 FTP FTP2.7.9 Tıbbi dökümanların özelliklerini öğrenir FTP FTP2.8. Tıbbi dökümanların kalitesinin yükseltilmesine yönelik olarak yapılan çalışmalar 39 7 FTP FTP2.8. Hasta dosyalarının düzenlenmesi ve indeksleri öğrenir 39 7 FTP FTP2.9. Bilgi ve belge ile ilgili temel kavramlar 39 7 FTP FTP2.9. Öğrenci bilgi ve bilgi kavramını tanımlar FTP FTP2.9.2 Bilgi ve belge arasında ki farkları bilir FTP FTP2.. Belge yönetimi-amacı-faydaları 39 7 FTP FTP2..3 Belge yönetimi hakkında bilgi sahibi olur FTP FTP2..4 Belge yönetiminin amacı ve faydalarını bilir FTP FTP2.. Bilgi ve belge hizmeti sunan kurumlar FTP FTP2.. Bilgi ve belge hizmeti sunan kurumları bilir 39 7 FTP FTP2.2. Hastanelerin sınıflandırılması, hastane fonksiyonları 39 7 FTP FTP2.2.6 Hastaneleri sınıflandırır FTP FTP2.2.7 Her bir sağlık hizmeti sunan yerlerin fonksiyonlarını bilir FTP FTP2.3. Sağlık kuruluşlarında evrak ve dosyalama hizmetleri 39 7 FTP FTP2.3.8 Dosyalama sistemini bilir FTP FTP2.3.9 Arşiv sistemini bilir. 22

123 Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 UyumHaftası Şubat 22 Tıbbi dökümantasyona giriş PY Şubat 22 Tıbbi dökümantasyona yönelik genel kavramlar PY3-PY Mart 22 Tıbbi doküman ve dökümantasyonun tarihçesi-i PY3-PY4-PY9 9-3 Mart 22 Tıbbi doküman ve dökümantasyonun tarihçesi-ii PY3-PY4-PY Mart 22 Tıbbi dökümantasyonunuluslar arası kullanımı ve Türkiye de sağlık kayıtları PY3-PY4-PY Mart 22 Tıbbi dökümantasyon çeşitleri PY3-PY4-PY9 28 Mart- Nisan Nisan 22 Tıbbi dökümanların taşıması gereken özellikler PY3-PY4-PY Nisan 22 Tıbbi dökümanların kalitesinin yükseltilmesine yönelik olarak yapılan çalışmalar PY3-PY4-PY Nisan 22 Bilgi ve belge ile ilgili temel kavramlar PY3-PY4-PY9 27 Nisan- Mayıs 22 Belge yönetimi-amacı-faydaları PY3-PY4-PY Mayıs 22 Bilgi ve belge hizmeti sunan kurumlar-i-ii PY3-PY4-PY9 3 - Mayıs 22 Hastanelerin sınıflandırılması, hastane fonksiyonları PY3-PY4-PY Mayıs 22 Sağlık kuruluşlarında evrak ve dosyalama hizmetleri PY3-PY4-PY8 3 Mayıs -7 Haziran 22 Yarıyıl sonu sınavları -2 Haziran 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. ) Aşağıdakilerden hangisi sağlık dökümanlarının tutuldukları yerlerden biri değildir? a. Hastane b. Hapishane c. Dispanser d. Sağlık ocağı e. Poliklinik 2) Hasta dosyalarının mülkiyeti kimindir? a. SGK b. Hastanın c. Doktorun d. Hastanenin e. Arşivin Örnek Sorular 3) Sağlıkla ilgili istatistiki verileri derleyen, bilimsel metotlarla analiz ederek ilgili birimlere rapor eden,tıbbi ünitelerdeki haberleşme ve yazışma hizmetlerini yürüten, bilgileri toplayıp belgeye dönüştüren,diploması Sağlık Bakanlığınca tescil edilen bir okuldan mezun olan sağlık meslek mensubuna ne isimverilir? a. Sağlık teknikeri b. Tıbbi personel c. Tıbbi sekreter d. Tıbbiyeli e. Sağlık sekreteri Cevap Anahtarı ) B 2) D 3) C Kaynak Kitap Uçmaz R. Tıbbi Dokümantasyon I-II, Uludağ Üniversitesi, 2. Artukoğlu A., Kaplan A., Yılmaz A. Yardımcı Kaynaklar ve Okuma Listesi Tıbbi Dokümantasyon, Türk Sağlık Eğitim Vakfı, Uçmaz R. Tıbbi Dokümantasyon I-II, Uludağ Üniversitesi, 2. 3.Sümbüloğlu V., Sümbüloğlu K. Tıbbi Dokümantasyon, Seçkin Kitapçılık,22. FTP-4 SAĞLIK PSİKOLOJİSİ ÖğretimÜyesi Elif BAYAZIT Oda Numarası E-posta DersZamanı Derslik 23

124 D er Okul Program Ders Konu Kazanım Kodu DersinAmacı.Hastalığınönlenmesiveiyiolmahalininarttırılmasındapsikolojininrolünüanalizedebilmek, 2. Farklıteorikperspektiflerdenfarklısağlıkdavranışları, tutumları, çıktılarıvehastalıklarıinceleyebilmek Konuveilgilikazanım 39 7 FTP FTP4.. PskikolojiyeGiriş 39 7 FTP FTP4.. Psikolojininamacınıaçıklayabilir 39 7 FTP FTP4..2 yaklaşımlaragörepsikolojininkonusunubilir 39 7 FTP FTP4..3 Psikolojininalanlarınıvefonksiyonlarınıbilir 39 7 FTP FTP4..4 Psikolojininkullandığıbilimselyöntemleribilir 39 7 FTP FTP4.2. SağlıkPsikolojisininÇalışmaAlanları 39 7 FTP FTP4.2. Kuramlaraçısındansağlıkdavranışınıaçıklayabilir 39 7 FTP FTP4.2.6 Fizikvesosyalçevreninorganizmaüzerineetkisinikavrar 39 7 FTP FTP4.2.7 Tutumlarınözellikleri, işlevlerivedavranışlailişkisiniaçıklayabilir 39 7 FTP FTP4.3. Algı 39 7 FTP FTP4.3.8 Algınınözelliklerinibilir 39 7 FTP FTP4.3.9 Algıyıetkileyeniçvedışetmenleriaçıklar 39 7 FTP FTP4.4. Bilinç 39 7 FTP FTP4.4. Normal bilinçkavramınıtanımlayabilir 39 7 FTP FTP4.4. Uykununbilinenyapısınıaçıklar 39 7 FTP FTP4.4.2 Uykubozukluklarınıbilir 39 7 FTP FTP4.4.3 Diğerbilinçdurumlarınıbilir 39 7 FTP FTP4.. ÖğrenmeveBelllek 39 7 FTP FTP4..4 Öğrenmekavramınıtanımlayabilir 39 7 FTP FTP4.. Klasikkoşulllanmayoluylayiaçıklar 39 7 FTP FTP4..6 Edimselkoşullanmayıaçıklar 39 7 FTP FTP4..7 Öğrenmeüzerineetkiliolanunsurlarıkavrar 39 7 FTP FTP4..8 Bellekveaşamalarınıbilir 39 7 FTP FTP4..9 Bellekgüçlendiriciyöntemleriaçıklar 39 7 FTP FTP4.6. KişilikVeGelişimDönemleri-KendiniGerçekleştirme 39 7 FTP FTP4.6.2 Kişilikvegelişimdönemlerininözelliklerini, bilir 39 7 FTP FTP4.6.2 Kişilikvegelişimdönemindegörülendeğişiklikleribilir 39 7 FTP FTP Kendinigerçekleştirenkişininözellikleriniaçıklar 39 7 FTP FTP Maslow unihtiyaçlarkuramınıkavrar 39 7 FTP FTP4.7. DavranışBozuklukları 39 7 FTP FTP Normal veanormaldavranışıtanımlayabilir 39 7 FTP FTP4.7.2 Anormaldavranışanedenolanfaktörleribilir 39 7 FTP FTP Nevrotikbozukluklarınözelliklerinibilir 39 7 FTP FTP Psikotikbozukluklarınözell 39 7 FTP FTP4.8. Öfke- Anksiyete- SavunmaMekanizmaları 39 7 FTP FTP Öfkenedenlerini, biçimlerinibilir 39 7 FTP FTP Öfkelibireydegörülenbelirtileriaçıklar 39 7 FTP FTP4.8.3 Öfkeyi control etmeyeyönelikuygulamalarıaçıklar 39 7 FTP FTP4.8.3 Anksiyetekavramınıtanımlayabilir 39 7 FTP FTP Anksiyetlibireydegörülenbelirtileriaçıklar 39 7 FTP FTP Kaygıylabaşaçıkmayollarınıbilir 39 7 FTP FTP Savunmamekanizmalarınınözelliklerinibilir 39 7 FTP FTP4.9. Zaman Yönetimi 39 7 FTP FTP4.9.3 Zaman yönetimininöneminibilir 39 7 FTP FTP Zaman yönetimiönündekiengelleriaçıklar 39 7 FTP FTP Zaman yönetimitekniklerinibilir 39 7 FTP FTP4.. Pediatrik-GeriatrikHastayaPsikolojikDestek 39 7 FTP FTP4..38 Çocuklarıngelişimdönemlerinin (fiziksel, zihinsel, duygusalvesosyal) özelliklerinibilir 24

125 39 7 FTP FTP4..39 Pediyatrikhastayayaklaşımilkelerinikavrar 39 7 FTP FTP4..4 Ihmalveistismarbelirtilerinikavrar 39 7 FTP FTP4..4 Ihmalveistismardurumundayapılacakpsikolojikdesteğibilir 39 7 FTP FTP4..42 Geriatrrihastalarınınözelliklerinibilir 39 7 FTP FTP4..43 Geriatric hastayayaklaşımilkelerinibilir 39 7 FTP FTP4.. SosyalHizmeteMuhtaç Hasta VeYaralılaraPsikolojikDestek/KayıplardaPsikolojikDestek 39 7 FTP FTP4..44 Sosyalendikasyonubilir 39 7 FTP FTP4..4 Sosyalhizmetemuhtaçhastalarayaklaşımıbilir 39 7 FTP FTP4..46 Ani ölümdurumundayapılacakpsikolojikdesteğibilir 39 7 FTP FTP4..47 Amputasyondurumundayapılacakpsikolojikdesteğibilir 39 7 FTP FTP4..48 Terminal dönemdeki hasta veyakınlarınaverilecekpsikolojikdesteğibilir 39 7 FTP FTP4.2. Afetlerde-TravmatikOlaylardaPsikolojikDestek 39 7 FTP FTP Afetzedelerdegörülecekruhsalbelirtileribilir 39 7 FTP FTP4.2. Ruhsalsorunlarlabaşetmeyollarınıaçıklar 39 7 FTP FTP4.2. Travmanınyarattığıruhsalsorunlarıaçıklar 39 7 FTP FTP4.2.2 TSSB ninözellikleriniveypılmasıgerekenleribilir 39 7 FTP FTP4.3. Tükenmişlik 39 7 FTP FTP4.3.3 Tükenmişiliksebepleriniaçıklar 39 7 FTP FTP4.3.4 Tükenmişlikbelirtileriniaçıklar 39 7 FTP FTP4.3. Tükenmişliktenkorunmakiçinalınacakönlemleriaçıklar Hafta-Tarih DersKonuları İlgili Program Yeterliği -4Şubat 22 UyumHaftası 2 7-2Şubat 22 PsikolojiyeGiriş PY-PY Şubat22 SağlıkPsikolojisininÇalışmaAlanları PY-PY Mart 22 Algı PY-PY 9-3 Mart 22 Bilinç PY-PY Mart 22 ÖğrenmeVeBellek PY-PY Mart 22 KişilikVeGelişimDönemleri KendiniGerçekleştirme PY-PY2 28 Mart- Nisan 22 Ara Sınav 8 6- Nisan 22 DavranışBozuklukları PY-PY Nisan 22 Öfke- Anksiyete- Çatışma- SavunmaMekanizmaları PY-PY 2-24 Nisan 22 Zaman Yönetimi PY-PY 27 Nisan-Mayıs22 Pediatric-GeriatrikHastayaPsikolojikDestek PY-PY Mayıs22 SosyalHizmeteMuhtaç Hasta veyaralılarapsikolojikdestek/ PY-PY2 KayıplardaPsikolojikDestek 3 -Mayıs22 Afetlerde-TravmatikOlaylardaPsikolojikDestek PY-PY Mayıs 22 Tükenmişlik PY-PY2 3 Mayıs-7Haziran22 DönemSonuSınavı -2 Haziran 22 BütünlemeSınavı Bu dersindeğerlendirmesi, Değerlendirme kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçmelibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır. 2

126 Örneksorular 4. Aşağıdakilerdenhangisininenuyguntanımıdır? a) Bireyiniçerisindeyaşadığıkültüründeğerlerinikazanmasüreci b) Bireyinçevresiyleetkileşimindemeydanagelendeğişme c) Yenivekalıcıbilgilerinedinilmesiiçinyararlanılanyöntem d) Tekrarya da yaşantılaryoluylameydanagelennispetenkalıcıdavranışdeğişikliği e) İstenilendavranışdeğişikliğinioluşturmakamacıylabireyingösterdiğibi linçliçaba. Anksiyeteilebaşetmedeuygulanacakgirişimlerleilgiliaşağıdaverilenl erdenhangisiyanlıştır? a) Hastanınanksiyetedüzeyibelirlenmelidir (hafif, orta, şiddetli, panik) b) Hasta yalnızbırakılmamalı, c) Çevreseluyaranlarattırılmalıdır d) Hastanınbaşetmemekanizmalarıbelirlenmeliveuygunbaşetmeyöntemi kullanımısağlanmalı 6. Çocuklarda cinsel istismar konusu ile ilgili aşağıdakilerden hangisi yanlıştır? a) Çocuklar bu konuda genellikle yalan söylemezler. İlk kural çocuğa inanmak olmalıdır. b) İstismarcılar genellikle yaşlı ve yabancı erkeklerle sokaktaki serserilerdir c) Mağdurlar her sosyo-ekonomik ve her sosyo-kültürel gruptan gelen kız ve erkek çocuklar olabilir d) Olayın olduğu yer genellikle ev, okul gibi çocuğun içinde bulunduğu yakın çevresidir CevapAnahtarı -b 2-d 3-c 4-b KaynakKitap Sarafino, E. & Smith, T.W. (2, 7th Ed) Health Psychology: Biopsychosocial interactions. Wiley. Morrison, V.& Bennett, P. (29 2nd Ed). An introduction to health psychology. Pearson. YardımcıKaynaklarve Okuma Listesi MEB. AlanlarOrtakSağlikPsikolojisi MEGEP Modülleri 26

127 DersinKa zanımları Okul Program Ders Konu Kazanım Kodu 2.SINIF GÜZ DÖNEMİ DERS PLANLARI FTP-2. ROMATİZMAL HASTALIKLAR VE FİZYOTERAPİ ÖğretimÜyesi Oda Numarası E-posta DersZamanı Derslik DersinAmacı Fizyoterapibölümüöğrencilerineromatizmalhastalıklarınoluşmekanizmalarını, hastalıkçeşitlerini,fizyoterapiverehabilitasyongereksinimnedenlerinivetedaviözelliklerinia nlatmakveuygulamalıolarakgöstererekromatolojikrehabilitasyonalanındakifizyoterapistini htiyaçduyacağıbilgivebeceriyiarttırmak Konuveilgilikazanım 39 7 FTP FTP2.. RomatolojikRehabilitasyonaGiriş, KavramlarveMultidisiplinerYaklaşım 39 7 FTP FTP2.. Romatizmalhastalıkpatofizyolojisiniöğrenir FTP FTP2..2 Romatizmalhstalıklarailışkinklinikkavramlarıbilir FTP FTP2..3 Romatizmalhastalıklarıntedavisinderolalanmultidiplinerekibibilir FTP FTP2.2. RomatolojikRehabilitasyondaDeğerlendirme 39 7 FTP FTP2.2.4 Romatizmalhastalıklardakifiziktedaviverehabilitasyondeğerlendir mesiniyapabilir FTP FTP2.3. RomatolojikRehabilitasyondaTedaviYaklaşımları, Biyopsikososyal Model ve Hasta Eğitimi 39 7 FTP FTP2.3. Romatolojikhastalıklararasındakifarklarıbilirvehastalıklarıayırtede bilir FTP FTP2.3.6 Hastanıntedaviihtiyacınıbelirlerveuygunegzersiztedavisinitayined er FTP FTP2.3.7 Hasta eğitimiverilir FTP FTP2.4. RomatolojikRehabilitasyondaTedaviYaklaşımları, AğrıYönetimivePsikolojikDesteğinRolü 39 7 FTP FTP2.4.8 Hastalıksüreçyönetimivebaşaçıkmateorilerinibilirböylecehastayab unayönelikdestekverilirevdüzenlemesiyapılır FTP FTP2.4.9 Ağrıkontrolünübilir FTP FTP2.. RomatolojikRehabilitasyondaTedaviYaklaşımları, EklemKorumaveYorgunlukYönetimi, OrtezveYardımcıCihazlarırolü 39 7 FTP FTP2.. Hastalığınalevlenmedönembelirtilerinibilirvebunayönelikhastayav erilecekkoruyucuyötemlere hakim olur FTP FTP2.. Hastalıktaoluşacakyorgunluğakarşıalınabilecekönlemleriöğrenir FTP FTP2..2 Ortezveyardımcıcihazlarıbilir FTP FTP2..3 Ortezveyardımcıcihazlarıhangihastalıktavehangiaşamadakullanac ağınıbilir FTP FTP2.6. İnflamatuarartritler, Romatoidartrit 39 7 FTP FTP2.6.4 Inflamatuarartritleribilirvediğerlerindenayırtedebilir FTP FTP2.6. Romatoidartritibilirvediğerlerindenayırtedilenözelliklerine hakim olur FTP FTP2.7. SeronegatifArtritler, AnkilozanSpondilit, PsöriatikArtrit, ReaktifArtrit, BehçetHastalığı 39 7 FTP FTP2.7.6 Seronegative atritleribilir. 27

128 39 7 FTP FTP2.7.7 Ankilozanspondilitibilir FTP FTP2.7.8 Psöriatikartritiöğrenirayırtedicibulgularınıöğrenir FTP FTP2.7.9 Reaktifartritibilir FTP FTP2.7.2 Behçethastalığınıvebugularınıbilir FTP FTP2.8. Pediatric romatolojikhastalıklar 39 7 FTP FTP2.8.2 Pediatridekarşımızaçıkanromatolojikhstalıklarıbilir FTP FTP Yetişkinromatolojikhastalıklarlaarasındaolanfarklarıöğrenir FTP FTP2.9. Osteoartrit 39 7 FTP FTP Osteoartritiöğrenirveinflamatuarhastalıklarlaarasındakifarkıayırte debilir FTP FTP2.. Osteoporoz 39 7 FTP FTP2..24 Osteoporozhastalığınıbilir FTP FTP2..2 Patolojikaşamalarınahakimdir FTP FTP2.. FibromyaljiSendromuveYaygınAğrıSendromları 39 7 FTP FTP2..26 Fibromiyaljisendromupatofizyolojisiniöğrenir FTP FTP2..27 Fibromiyaljisendromunutanımlarvebilir FTP FTP2..28 Yaygınağrısendrompatofizyolojisinibilir FTP FTP2..29 Yaygınağrısendromhastalığınıöğrenir FTP FTP2.2. KonnektifDokuHastalıkları, Sistemik Lupus Eritematozus, Skleroderma, Myozitler 39 7 FTP FTP2.2.3 KonnektifDokuHastalıkları, Sistemik Lupus Eritematozus, Skleroderma, Myozitlerinpatofizyolojisinibilir FTP FTP2.2.3 Konnektifdokuhastalıklarınıöğrenir FTP FTP Sistemik lupus hastalığınıöğrenir FTP FTP Sistemik lupus eritematozussklerodermhastalığınıbilir FTP FTP Miyozitleriöğrenir FTP FTP2.3. ÇeşitliDurumlar, Septikartrit, Gut, Sarkoidoz, Diabetus Mellitus, 39 7 FTP FTP2.3.3 Vaskülitler ÇeşitliDurumlar, Septikartrit, Gut, Sarkoidoz, Diabetus Mellitus, Vaskülitlergibihastalıklarınpatofizyolojisinibilir FTP FTP Septikartrithastalığınıbilir FTP FTP Gut hastalığınıöğrenir FTP FTP Sarkoidozhastalığınıbilir FTP FTP Diabetes mellitus hastalığınıbilir FTP FTP2.3.4 Vaskülitleriöğrenir. Hafta-Tarih DersKonuları İlgili Program Yeterliği Eylül 29 UyumHaftası 2 3 Eylül 29 RomatolojikRehabilitasyonaGiriş, KavramlarveMultidisiplinerYaklaşım PY2 3 7Ekim 29 RomatolojikRehabilitasyondaDeğerlendirme PY4 PY 4 4 Ekim 29 RomatolojikRehabilitasyondaTedaviYaklaşımları, Biyopsikososyal Model ve Hasta Eğitimi PY4 PY 2 Ekim 29 RomatolojikRehabilitasyondaTedaviYaklaşımları, AğrıYönetimivePsikolojikDesteğinRolü PY4 PY 6 28 Ekim 29 RomatolojikRehabilitasyondaTedaviYaklaşımları, EklemKorumaveYorgunlukYönetimi, PY4 PY OrtezveYardımcıCihazlarıRolü 7 4Kasım 29 İnflamatuarartritler, Romatoidartrit PY3 9-7 Kasım 29 Ara sınav 8 8Kasım 29 SeronegatifArtritler, AnkilozanSpondilit, PsöriatikArtrit, ReaktifArtrit, BehçetHastalığı PY3 9 2Kasım 29 PediatrikRomatolojikHastalıklar PY3 PY7 2Aralık 29 Osteoartrit PY3 PY7 9Aralık 29 Osteoporoz PY4 PY PY3 2 6Aralık 29 FibromyaljiSendromuveYaygınAğrıSendromları PY4 PY PY3 3 23Aralık 29 KonnektifDokuHastalıkları, Sistemik Lupus Eritematozus, PY4 PY PY3 28

129 Değerlendirme Örneksorular Bu dersindeğerlendirmesi, kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır..)aşağıdakihastalıklardanhangisiakutmonoartritayırıcıtanısındaöncelikledüşünülme z? A) Gut B) Psödogut C) Septikartrit D) Palindromikromatizma E) Pigmentevillonodülersinovit 2.)AşağıdakilerdenhangisiAkutEklemRomatiz- masıtanısıiçinçokdeğerlidir? A) Ateş B) Gezicipoliartrit C) CRP pozitifliği D) ASO pozitifliği E) EKG de P-R mesafesindeuzama 3.)Aşağıdakihastalıklardanhangisipolimiyaljiromatikaayırıcıtanısındadüşünülmez? A) Fibromiyalji B) Romatoidartrit C) Metabolikmiyopatiler D) Enfeksiyözmiyopatiler E) Enflamatuvarmiyopatiler CevapAnahtarı.D 2.B 3.C KaynakKitap Romatoloji El Kitabı, Çev. Ed. Doç.Dr.Hüseyin T.E. Özer, Doç.Dr. RenginGüzel. Nobel TıpKitabevleri, 29 RomatolojiVakaDerlemeleri-I.Ed. Prof. Dr. Mehmet Sayarlıoğlu. RAED, 2. RomatolojiVakaDerlemeleri-II. Ed. Doç.Dr. Ahmet Mesut Onat. RAED, 22. RomatizmalHastalıklardaKlinikTedavi. Çev. Ed. Prof.Dr. AyhanDinç. RAED, Yüce Yay., 27. YardımcıKaynaklarve Okuma Listesi Tidy's Physiotherapy. Çev.Ed. Prof.Dr. Edibe Yakut, Prof. Dr. HülyaKayıhan. Pelikan Yay., 28. Kelly's Text Book of Rheumatology. Ed. Gary S. Firestain. Pheledelphia,Elsevier, 29. Skleroderma, Myozitler 4 3 Aralık 29 ÇeşitliDurumlar, Septikartrit, Gut, Sarkoidoz, Diabetus Mellitus, Vaskülitler 4-2 Ocak 22 DönemSonuSınavı 2-26 Ocak 22 BütünlemeSınavı PY4 PY PY3 FTP-23ORTOPEDİK HASTALIKLAR VE FİZYOTERAPİ ÖğretimÜyesi Oda Numarası E-posta 29

130 DersinKazanımları Okul Program Ders Konu Kazanım Kodu DersZamanı Derslik DersinAmacı Öğrencilere kas iskeletsisteminiilgilendirenhastalıklarınkonservatifveyacerrahitedavilerindensonrakigenel rehabilitasyonprensiplerinivermek, kırık, sportif yaralanmalar, aşırıkullanımabağlıyumuşakdokuyaralanmalarındakigeneldeğerlendirmeverehabilitasyon programlarınıoluşturmabecerisinigeliştirmek. Konuveilgilikazanım 39 7 FTP FTP23. Ortopedikrehabilitasyonagiriş 39 7 FTP FTP23.. Ortopedikrehabilitasyontanımınıyapar 39 7 FTP FTP23..2 Ortopedikrehabilitasyondakıllanılanklinikkavramlarıbilir FTP FTP23.2. Ortopedikrehabilitasyonunönemiveamaçları, Ortopedikrehabilitasyondageneldeğerlendirmevetedaviprogramı 39 7 FTP FTP Ortopedikrehabilitasyonuönemlikılansebepleriveamaçlarıbilir FTP FTP Ortopedikrehabilitasyondagenelfiziktedavideğerlendirmessiiyapab iir FTP FTP23.2. Yapılandeğerlendirmeile parallel tedaviplanınıçizebilir FTP FTP23.3. Kırıktedavisiverehabilitasyonu 39 7 FTP FTP Kırıktanımınıbilir FTP FTP Kırıktürleriniöğrenir FTP FTP Kırıkrehabilitasyonuhakkındabilgiyesahipolur FTP FTP23.4. Romatoidartrit -osteoartritrehabilitasyonu 39 7 FTP FTP Romatoidartritibilir FTP FTP23.4. Romatoidartritrehabilitasyonunuvedikkatedilmesigerekennoktalar ıöğrenir FTP FTP23..3 Ankilozonspondilithastalığınıöğrenir FTP FTP23..4 AS hastalığındarehabilitasyonuvedikkatedilmesigerekennoktalarıöğre nir FTP FTP23.. Non-artikülerromatizmalhstalıklarıbilir FTP FTP23.4. Osteoartrittanımınıbilir FTP FTP Osteoartritrehabilitasyonuvedikkatedilmesigerekennoktalarıöğren ir FTP FTP23.. AnkilozanSpondilitveRehabilitasyonu, NonartikülerromatizmalhastalıklarveRehabilitasyonu 39 7 FTP FTP23..6 Nonartikülerromatizmalhastalıklardarehabilitasyonuvedikkatedilmesi gerekennoktalarıöğrenir FTP FTP23.6. PFAS verehabilitasyonu 39 7 FTP FTP PFAS hastalığınıverahabilitasyonunuöğrenir FTP FTP23.7. ÖnÇaprazBağyaralanmalarıveÖnÇaprazÖnçaprazBağyaralanmala rıverehabilitasyonu MenisküsyaralanmalarıveRehabilitasyonu 39 7 FTP FTP Önçaprazbağyaralanmalarınıöğrenirvedeğerlendirmesiniyapar FTP FTP Önçaprazbağyaralanmalarındarehabilitasyonuvedikkatedilmesiger ekennoktalarıöğrenir FTP FTP Menisküsyaralanmalarınıveçeşitlerinibilir FTP FTP Mesnisküsyaralanmalarındarehabilitasyonuvedikkatedilmesigerek ennoktalarıöğrenir FTP FTP23.8. Artroplastilerverehabilitasyonu FTP FTP Artroplastitanımınıyapabilir FTP FTP23.9. Artroplastilerverehabilitasyonu FTP FTP Artroplastiçeşitlerinive hasta seçiminiöğrenir FTP FTP23.. Artroplastilerverehabilitasyonu -3 3

131 39 7 FTP FTP Artropilastirehabilitasyonunuvedikkatedilmesigerekennoktalarıöğ renir FTP FTP23.. Omuzproblemlerinderehabilitasyon 39 7 FTP FTP23..2 Omuzdagörülenpatolojileribilir FTP FTP Omuzdagörülenpatolijileringenelrehabilitasyonbakışaçısınıöğreni rvedikkatedilmesigereknnoktlarıöğrenir FTP FTP23.2. Bandajlamayöntemleri 39 7 FTP FTP Bandajtürleriniveneredehangitürkullacaköğrenir FTP FTP Bandajlamayöntemleriniöğrenirveuygulamasınıyapabilir FTP FTP23.3. Geneltartışma 39 7 FTP FTP Genelortopedikrehabilitasyonprotokollerinigözdengeçirirvearasın dakifarlarıöğrenir. Hafta-Tarih DersKonuları İlgili Program Yeterliği Eylül 29 UyumHaftası 2 4Ekim 29 Ortopedikrehabilitasyonagiriş PY 3 Ortopedikrehabilitasyonunönemiveamaçları, Ekim 29 Ortopedikrehabilitasyondageneldeğerlendirmevetedaviprogramı PY PY 4 8 Ekim 29 Kırıktedavisiverehabilitasyonu PY3 PY 2Ekim 29 Romatoidartrit- Osteoartritrehabilitasyonu PY3 PY 6 AnkilozanSpondilitveRehabilitasyonu, NonartikülerromatizmalhastalıklarveRehabilitasyonu Kasım 29 PY3 PY 7 8 Kasım 29 PFAS verehabilitasyonu PY3 PY 9-7 Kasım 29 Ara Sınav 8 ÖnÇaprazBağyaralanmalarıveÖnÇaprazÖnçaprazBağyaralanmalar 22Kasım 29 ıverehabilitasyonu PY4 PY3 MenisküsyaralanmalarıveRehabilitasyonu 9 29Kasım 29 Artroplastilerve Rehabilitasyon- PY4 PY3 6Aralık 29 Artroplastilerve Rehabilitasyon-2 PY4 PY3 3Aralık 29 Artroplastilerve Rehabilitasyon-3 PY4 PY3 2 2Aralık 29 OmuzProblemlerindeRehabilitasyon PY PY 3 27Aralık 29 Bandajlamayöntemleri PY PY 4 3 Ocak 22 Geneltartışma PY2 PY 4-2 Ocak 22 DönemSonuSınavı 2-26 Ocak 22 BütünlemeSınavı Değerlendirme Bu dersindeğerlendirmesi, kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır. 3

132 Örneksorular. )Dupuytrenkontraktürü ensıkneredeortayaçıkar? A) Birinciparmakta B) İkinciparmakta C) Üçüncü parmakta D) Dördüncü parmakta E) Birinciveikinciparmakarasında 2. )Aşağıdakieklemlerdenhangisinintutulumu sekonderosteoartritidüşündürmelidir? A) Distal interfalangeal B) Proksimalinterfalangeal C) Dirsek D) Kalça E) Birincimetatarsofalangeal 3.)Aşağıdakilerdenhangisiosteoartritlibirhastanınelindegözlenirveromatoidartri ttenayırmadakul- lanılabilir? A) Simetriktutulum B) Kemikhipertrofisi C) Metakarpofalangealtutulum D) El-bilekeklemitutulumu E) Subluksasyon CevapAnahtarı.D 2.C 3.B KaynakKitap Brotzman SB. Handbook of orthopaedic Rehabilitation, Mosby, 27 YardımcıKaynaklarve Okuma Listesi - FTP-2NÖROLOJİKHASTALIKLAR VE FİZYOTERAPİ ÖğretimÜyesi Oda Numarası E-posta DersZamanı Derslik DersinAmacı Nörolojikhastalıklarınkliniközellikleri, insanvücudundameydanagetirdiğibulguvebelirtilerinoluşummekanizmaları, nörolojikrehabilitasyondakullanılanölçmedeğerlendirmeyöntemlerivebuhastalıklarınrehabilitasyonundakullanılannörofizyolojiktem ellitekniklerinvakaözelliklerinegörekullanımlarınınkavranmasınısağlamak, nörolojikrehabilitasyonalanındaklinikkararvermeve problem çözmebecerisinigeliştirmektir. 32

133 DersinKazanımları Okul Program Ders Konu Kazanım Kodu Konuveilgilikazanım 39 7 FTP FTP2.. Medulla spinalis yaralanmalarınınoluşummekanizmalarıveözellikleri 39 7 FTP FTP2.. Nörolojikhastalıklarınkliniközelliklerinitanımlar FTP FTP2..2 Hastalıklarımerkeziveperiferiksinirsistemietkilenimözelliklerinegö resınıflandırıp, alt veüst motor nöronetkilenimlerininkliniközelliklerinitanımlar FTP FTP2..3 Yaralanmalarınoluşummeknızmalarınıbilir FTP FTP2.2. Spastisiteninpatofizyolojisi, değerlendirmeveinhibisyonyöntemleri 39 7 FTP FTP2.2.4 Alt veüst motor nöronetkilenimlerinindeğerlendirilmesineaittemelvenörofizyolojik özellikliölçmevedeğerlendirmeyöntemlerinikavrar FTP FTP2.2. Spasiteninpatofizyolojisinibilir FTP FTP2.2.6 Inhibisyonyöntemlerinibilir FTP FTP2.3. Tam vekısmikesilerde medulla spinalis yaralanmalarınınseviyeleregörekliniközelliklerivetedaviyöntemler i 39 7 FTP FTP2.3.7 Nörolojikhastalığınvücutfonksiyonları, aktivitevekatılımüzerineolanetkilerinitanımlarveklinikkararvermes ürecindetedaviprogramınıplanlar FTP FTP2.3.8 Tam vekısmikesikavramlarınıbilir FTP FTP2.3.9 Yaralanmaseviyerininvücuttakikarşılığınıöğrenir FTP FTP2.3. Hastalığauygunnörofizyolojiktemellitedaviprogramınıseçerveteme ldüzeydeuygular FTP FTP2.4. Normal hareketioluşturankomponenetlerveataksinintanımı, patofizyolojisiveölçme-değerlendirmeyöntemleri 39 7 FTP FTP2.4. Normal hareketkompenentlerinibilir FTP FTP2.4.2 Ataksinintanımınıyaparveataksitürleriniöğrenir FTP FTP2.4.3 Ataksininpatofizyolojisinibilir FTP FTP2.4.4 Ataksinindeğerlendirmeyöntemveparemetrelerinibilir FTP FTP2.. Ataksitiplerineözelnörofizyolojiktemellitedaviyöntemleriveuygul amaları 39 7 FTP FTP2.. Ataksitürünegöretedavideğerlendirmesiniyapabilir FTP FTP2..6 Tedaviprogramınıçizebilirveuygulamayıbilir FTP FTP2.6. Multiplsklerozunkliniközellikleri, ölçmedeğerlendirmeyöntemleriverehabilitasyonu 39 7 FTP FTP2.6.7 MS hastalığınınpatofizyolojisiniöğrenir FTP FTP2.6.8 MS hastalığınınkliniközelliklerinibilirvetipleriniöğrenir FTP FTP2.6.9 MS hastalığındafiziktedavideğerlendirmesinibilirveuygulamabasamak larınıöğrenir FTP FTP2.6.2 MS hastalıktedavisiniyapabilir FTP FTP2.7. Parkinson hastalığınınkliniközellikleriveölçmedeğerlendirmeyöntemleri 39 7 FTP FTP2.7.2 Parkinson hastalığınınpatofizyolojisinibilir FTP FTP Parkinson hastalığınınkliniközellikleriniöğrenir FTP FTP Parkinson hastalığındatemelfiziktedavideğerlendirmesiniyapabilir FTP FTP2.8. Parkinson hastalığındarehabilitasyonyöntemleri 39 7 FTP FTP Parkinson hastalığındatemeldeğerlendirmesonucunagöreuygutedaviprogramı nıçizerekuygulamasınıyapabilir FTP FTP2.8.2 Hasta evegzersizprogramınıvedestekyöntemlerinibilir FTP FTP2.9. Periferiknöropatilerverehabilitasyonu 33

134 39 7 FTP FTP Periferiknöropatilerinpatofizyolojisinibilir FTP FTP Oluşannöropatiyeyönelikrehabilitasyonprohramınıoluşturupuygul amasınıyapabilir FTP FTP2.. Nöromuskülerhastalıklarverehabilitasyonu 39 7 FTP FTP2..28 Nöromuskülerhastalıklaroluşummekanizmasınıbilir FTP FTP2..29 Nöromuskülerhastalıklardakirehabilitasyonprensiplerinibilirveuyg ulamasınıyapabilir FTP FTP2.. Spina bifida verehabilitasyonu 39 7 FTP FTP2..3 Spina bifida kliniközelliklerinibilir FTP FTP2..3 Spina bifida değerlendirmesiniyaparverehabilitasyonprogramınıoluşturarakuyg ulayabilir FTP FTP2.2. Disk hernileriverehabilitasyonu 39 7 FTP FTP Disk hernilerikliniközelliklerinibilir 39 7 FTP FTP Diskhernileritemelfiziktedavideğerlendirmesiniyapabilirverehabili tasyonunuuygulayabilir FTP FTP2.3. SAK, kafatravmaları, spinal veintrakraniyaltümörlerverehabilitasyonu 39 7 FTP FTP SAK, kafatravmaları, spinal veintrakraniyaltümörlerinoluşummekanizmasınıöğrenir FTP FTP2.3.3 Temelfiziktedaviverehabilitasyondeğerlendirmesiniyaparakrehabi litasyonunuuygulayabilir. Hafta-Tarih DersKonuları İlgili Program Yeterliği Eylül 29 UyumHaftası 2 EKİM 29 Medulla spinalis yaralanmalarınınoluşummekanizmalarıveözellikleri PY PY2 3 8Ekim 29 Spastisiteninpatofizyolojisi, değerlendirmeveinhibisyonyöntemleri PY PY2 4 Ekim 29 Tam vekısmikesilerde medulla spinalis yaralanmalarınınseviyeleregörekliniközelliklerivetedaviyöntemleri PY PY2 22Ekim 29 Normal hareketioluşturankomponenetlerveataksinintanımı, patofizyolojisiveölçme-değerlendirmeyöntemleri PY PY2 6 2 Kasım 29 Ataksitiplerineözelnörofizyolojiktemellitedaviyöntemleriveuygula maları PY PY6 7 Kasım 29 Multiplsklerozunkliniközellikleri, ölçmedeğerlendirmeyöntemleriverehabilitasyonu PY PY Kasım 29 Ara Sınav 9 9Kasım 29 Parkinson hastalığındarehabilitasyonyöntemleri PY PY 26Kasım 29 Periferiknöropatilerverehabilitasyonu PY2 PY 3Aralık 29 Nöromuskülerhastalıklarverehabilitasyonu PY4 PY 2 Aralık 29 Spina bifida and rehabilitasyonu PY4 PY PY7 3 7Aralık 29 Disk hernileriverehabilitasyonu PY8 PY2 4 24Aralık 29 SAK, kafatravmaları, spinal veintrakraniyaltümörlerverehabilitasyonu PY8 PY2 4-2 Ocak 22 DönemSonuSınavı 2-26 Ocak 22 BütünlemeSınavı Bu dersindeğerlendirmesi, Değerlendirme kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır. 34

135 Örneksorular.)Aşağıdakiuygulamalardanhangisihemiplejirehabilitasyonuprensiplerindendeğildir? A) Mümkünolduğuncahastanıntedaviyeaktifkatılımısağlanmalıdır. B) Tedavi hem nöral hem de non-nöralvücutyapılarınıkapsamalıdır. C) Hasta gereksizyorulmamalı, değerlendirmevetedaviprogramısadeceetkilenmiş olantarafiçinyapılmalıdır. D) Gövdeveboyunstabilizasyonudeğerlendirmevetedavide ilk sıralardayeralmalıdır. 2.)Aşağıdakilerdenhangisi Parkinson rehabilitasyonununtemelprensipleriarasındayeralmaz? A) Egzersizlerparçadanbütüne, şuurludanoto- matiğedoğruilerlemelidir. B) Dinamikegzersizlerdenkaçınılmalı, özelliklestatikstabilizasyonçalışılmalıdır. C) Egzersizlersırasındahareketikolaylaştırıcıgörselveişitselgeribildirimlerkullanılmalıdı r. D) Hastalığın off dönemlerindehastanınaktifkatılımınıgerektirmeyenuygulamalartercihedilmelidir. 3.)Yürümeaktivitesisırasında her adımatmadadevamlıolarakayağınınyeretakılmasındanşikâyetedenbirhemiplejik hasta içinaşağıda- kilerdenhangisisöylenemez? A) Tibialis anterior kas inaktiftir. B) Gastrocnemius kasıspastiktir. C) Quadriceps kasıspastiktir. D) Kalçafleksörlerispastiktir. CevapAnahtarı.C 2.B 3.D KaynakKitap YardımcıKaynaklarve Okuma Listesi Algun C. UygulamalıFizikTedaviveRehabilitasyon. HacettepeÜniversitesiFizikTedaviveRehabilitasyonYüksekokuluYayınları: Ankara 99. Edwards S. Neurological physiotherapy: A problem-solving approach Elsevier Health Science 22 Armutlu K, Spasticity and its managements with physical therapy applications in Multiple sclerosis patients. Nova Publisher 29 FTP-27 KARDİYO-PULMONER HASTALIKLAR REHABİLİTASYONU Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Kardiyovasküler problemi olan hastalarda, problemlerintanınması, uygun 3

136 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu değerlendirme yöntemleri ile hastaların değerlendirilmesi, kardiyak rehabilitasyon yaklaşımları ve uygulamalarının seçimi ile hastaya uygun tedavi programının planlanması ve uygulanabilmesinin sağlanması. Solunum problemi olan hastalarda bu problemin tanınması, uygun değerlendirme yöntemleri ile hastaların değerlendirilmesi, solunum fizyoterapi yaklaşımları ve pulmoner rehabilitasyon uygulamalarının seçimi ile hastaya uygun tedavi programının planlanması ve uygulanabilmesinin sağlanması. Konu ve ilgili kazanım 39 7 FTP FTP27.. Ders içeriği ve tanımlanması, Kardiyak rehabilitasyonun tarihçesi, tanımı ve komponentleri. Major kalp hastalıkları tanımı ve genel özellikleri 39 7 FTP FTP27.. Kardiak rehabilitasyonun tarihçesini bilir FTP FTP27..2 Karidak rehabilitasyonu tanımlar ve komponentlerini ayırır FTP FTP27..3 Majör kalp hastalıklarını tanımlar FTP FTP Kardiyovasküler değerlendirme ve elektrokardiyografi Erken dönem kardiyak rehabilitasyon programı 39 7 FTP FTP Kardio-vasküler değerlendirmeyi bilir 39 7 FTP FTP Elektrokardiografi tanır 39 7 FTP FTP Erken dönem karidak rehabilitasyon programını bilir FTP FTP Değiştirilebilen risk faktörleri ve tedavisi I- II- III 39 7 FTP FTP Risk faktörlerini bilir FTP FTP Kardiyovasküler hastalıklarda kullanılan egzersiz testleri Egzersiz eğitimi ve dış hasta kardiyak rehabilitasyon programı 39 7 FTP FTP Egzersiz testlerini bilir FTP FTP Egzersiz egitimi ve hastane dışı kardiak rehabilitasyon programını bilir FTP FTP27.. Revaskülarizasyon ve kardiyak cerrahiden sonra kardiyak rehabilitasyon.kardiyak rehabilitasyonda hasta eğitimi 39 7 FTP FTP27.. Cerrahi sonrası kardiak rehabilitasyonu bilir FTP FTP27..2 Hasta eğitimi konusunda bilgi sahibi olur FTP FTP Koruyucu kardiyak rehabilitasyon. Periferik damar hastalıklarında rehabilitasyon 39 7 FTP FTP Koruyucu rehabilitasyon hakkında bilgi sahibi olur 39 7 FTP FTP Periferik damar hastalıklarında rehabilitasyonunu tanır. Ders içeriği ve tanımlanması, Pulmoner rehabilitasyonun 39 7 FTP27 7 tanımı ve gerekli komponentler FTP Obstrüktif akciğer hastalıklarının patofizyolojisi ve rehabilitasyonu 39 7 FTP FTP Pulmoner rehabilitasyonu tanımlar ve komponentlerini bilir 39 7 FTP FTP Obstrüktif akciğer hastalılarını bilir ve rehabilitasyonu tanır. Restriktif akciğer problemlerinin patofizyolojisi ve 39 7 FTP27 8 rehabilitasyonu FTP Pulmoner rehabilitasyonda kullanılan değerlendirme yöntemleri 39 7 FTP FTP Pulmoner rehabilitasyonda değerlendirmeyi bilir FTP FTP Restriiktif akciğer hastalılarını ve rehabilitasyonunu tanır FTP FTP Pulmoner rehabilitasyonda egzersiz eğitimi, fiziksel aktivite Solunum egzersizleri, solunum eğitimi 39 7 FTP FTP Pulmoner egzersizleri bilir 39 7 FTP FTP Solunum egzersizlerini ve eğitimini tanır FTP FTP27.. Havayolu temizleme teknikleri-i II 36

137 39 7 FTP FTP27..2 Havayolu temizleme tekniklerini tanır FTP FTP27.. Havayolu temizleme teknikleri-iii Pulmoner cerrahide rehabilitasyon 39 7 FTP FTP Cerrahi sonrası pulmoner rehabilitasyonu tanır. Yoğun bakımda pulmoner rehabilitasyon 39 7 FTP27 2 Solunum problemi olan neonatallerde ve pediatrik hastalarda FTP fizyoterapi ve rehabilitasyon 39 7 FTP FTP Yoğun bakımda pulmoner rehabilitasyonu bilir FTP FTP Pediatrik pulmoner rehabilitasyonu tanır FTP FTP Günlük yaşam aktiviteleri ve enerji tüketimi 39 7 FTP FTP Pulmoner rehabilitasyonda Günlük yaşam aktivitelerini bilir 39 7 FTP FTP Enerji mekanizmalarını bilir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği 23-27EYLÜL 29 Uyum haftası PY 2 4 EKİM 29 Ders içeriği ve tanımlanması, Kardiyak rehabilitasyonun tarihçesi, tanımı ve komponentleri. PY3-PY4-PY9 Major kalp hastalıkları tanımı ve genel özellikleri 3 EKİM 29 Kardiyovasküler değerlendirme ve elektrokardiyografi Erken dönem kardiyak rehabilitasyon programı PY3-PY4-PY9 4 8 EKİM 29 Değiştirilebilen risk faktörleri ve tedavisi I- II- III PY3-PY4-PY 2 EKİM 29 Kardiyovasküler hastalıklarda kullanılan egzersiz testleri Egzersiz eğitimi ve dış hasta kardiyak rehabilitasyon programı PY3-PY4-PY 6 KASIM 29 Revaskülarizasyon ve kardiyak cerrahiden sonra kardiyak rehabilitasyon.kardiyak rehabilitasyonda hasta eğitimi PY3-PY4-PY 7 8 KASIM 29 Koruyucu kardiyak rehabilitasyon. Periferik damar hastalıklarında rehabilitasyon PY3-PY4-PY 9-7 Kasım KASIM 29 Ders içeriği ve tanımlanması, Pulmoner rehabilitasyonun tanımı ve gerekli komponentler PY3-PY4-PY Obstrüktif akciğer hastalıklarınınpatofizyolojisive rehabilitasyonu 9 29 KASIM 29 Restriktif akciğer problemlerinin patofizyolojisi ve rehabilitasyonu PY3-PY4-PY Pulmoner rehabilitasyonda kullanılan değerlendirme yöntemleri 6 ARALIK 29 Pulmoner rehabilitasyonda egzersiz eğitimi, fiziksel aktivite Solunum egzersizleri, solunum eğitimi PY3-PY4-PY 3 ARALIK 29 Havayolu temizleme teknikleri-i II PY3-PY4-PY 2 2 ARALIK 29 Havayolu temizleme teknikleri-iii Pulmoner cerrahide rehabilitasyon PY3-PY4-PY 3 27 ARALIK 29 Yoğun bakımda pulmoner rehabilitasyon Solunum problemi olan neonatallerde ve pediatrik hastalarda PY3-PY4-PY fizyoterapi ve rehabilitasyon 4 3 OCAK 22 Günlük yaşam aktiviteleri ve enerji tüketimi PY3-PY4-PY 4-2 Ocak 22 Yarıyıl sonu sınavları 2-26 Ocak 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli ve D/Y bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. - Sağ atriumdan kirli kan sol ventriküle geçer? Örnek Sorular 2- Solunum sisteminde oksijen kana alveoller arterlerden geçer? 3- Aşağıdakilerden hangisi kalpten çıkan ana arterdir? a- Femoral arter b- radial arter c- Aort d- axiller arter e- pulmoner arter Cevap Anahtarı - Yanlış 2- doğru 3- c Kaynak Kitap AmericanAssociation of CardiovascularandPulmonaryRehabilitation. 37

138 Okul Program Ders Konu Kazanım Kodu GuidelinesforCardiacRehabilitationandSecondaryPreventionprograms. th ed. Champaign, IL: Human Kinetics, 23. Thow M. ExerciseLeadership in CardiacRehabilitation: An Evidence- BasedApproach. st ed. Singapore: Wiley, 26 ACSM'sGuidelinesforExerciseTestingandPrescription. 9th ed. Philadelphia: Lippincott Williams &Wilkins, 23. Hacettepe Üniversitesi, e-kaynaklar, pubmed, WOS Yardımcı Kaynaklar ve Okuma Listesi.Hodgkin JE, Celi BR, Connors GA. PulmonaryRehabilitation: GuidelinestoSuccess. 4th ed. St Louis, MO: Mosby, 28. Main E, Denehy L. CardiorespiratoryPhysiotherapy: AdultsandPaediatrics. th ed. Edinburgh: Churchill Livingstone, 26. AmericanAssociation of CardiovascularandPulmonaryRehabilitation. GuidelinesforPulmonaryRehabilitation Programs. 4th ed. Champaign, IL: Human Kinetics, 2. Hacettepe Üniversitesi, e-kaynaklar (PubMed, WOS) FTP- 29 YAŞLILARDA HASTALIKLAR VE FİZYOTERAPİ ÖğretimÜyesi Oda Numarası E-posta DersZamanı Derslik DersinAmacı Yaşınilerlemesiilebirliktemeydanagelenfizyolojikdeğişiklikleriaçıklamak,sağlıklıveözürlüyaşlılariçingereklideğerlendirmeveegzersizprogramlarıkonusundakiuygu lamalarınkavranmasınısağlamak, sağlıklıyaşlanmaveyaşamkalitesikonusundabilinçlendirmektir. Konuveilgilikazanım 39 7 FTP FTP29.. Gerontoloji, GeriatriVeYaşlanmaileilgilitanımlar 39 7 FTP FTP29.. Gerontoloji,geriatriveyaşlılıktanımlarınıyapar FTP FTP29..2 Geriatriksağlıklıve hasta kişilerdegözlenenkliniközellikleritanımlarveuygunfizyoterapivere habilitasyonyaklaşımlarıylailişkilendirir FTP FTP29.2. Yaşlanmailemeydanagelenfizyolojikdeğişimler FTP FTP Yaşlanmasüreciningetirdiğikliniközellikleribilir FTP FTP Yaşlanmanınfizyolojisiniöğrenir FTP FTP FTP FTP29.3. Kasiskeletsistemindeyaşlanmailemeydanagelenfizyolojikdeğişiklikler Yaşlanmanın kas iskeletsistemiüzerindemeydanagetirdiğifizyolojikdeğişiklikleriöğr enir. 38

139 39 7 FTP FTP29.4. Sinirsistemindeyaşlanmailemeydanagelenfizyolojikdeğişiklikler 39 7 FTP FTP Yaşlanmanınsinirsitemiüzerindemeydanagetirdiğifizyolojikdeğişi klikleriöğrenir FTP FTP29.. Kardiyopulmonersistemdeyaşlanmailemeydanagelenfizyolojikdeğ işiklikler 39 7 FTP FTP29..7 Yaşlanmanınkardiyopulmoner system üzerindemeydanagetirdiğifizyolojikdeğişiklikleriöğrenir FTP FTP29.6. Yaşlanmaileortayaçıkanduyu-algı-motor değişiklikler 39 7 FTP FTP Normal duyualgı motor gelişimibilir FTP FTP Yaşlanmanınduyualgı motor sistemüzerindemeydanagetirdiğifizyolojikdeğişiklikleriöğrenir 39 7 FTP FTP29.7. Fonksiyoneldeğerlendirmeyöntemlerivedüşmeler 39 7 FTP FTP29.7. Yaşlılardakifonksiyoneldeğerlendirmetestleriniöğrenir FTP FTP29.7. Geriatric rehabilitasyondadüşmetürlerinibilirvealınabilecekkoruyucupozisy onlarıöğrenir FTP FTP29.8. Geriatridemultidisiplinerekipçalışmasınınönemi 39 7 FTP FTP Geriatridegörevalanmultidisiplinerekipüyelerinibilirvebirlikteçalış manınönemininbilgisinesahiptir FTP FTP29.9. Yaşlılarauygunegzersizprogramları 39 7 FTP FTP Yaşlılardagörülensemptomlaragöreuygunegzersizprohgramınıhazı rlamayıöğrenirveuygulamasınıbilir FTP FTP29.. Sağlıklıyaşlanmaveyaşamkalitesi 39 7 FTP FTP29..4 Sağlıklıyaşlanmatanımlamasınıyapabilirvegerekliolanfaktörleriöğ renir FTP FTP29.. Yaşamkaliteparemetreleriniöğrenir FTP FTP29.. Yaşlılıktafizyoterapiyeyönelikçalışmaalanları 39 7 FTP FTP29..6 Yaşlılıktafizyoterapiçalışmaalanlarınıbilir FTP FTP29.2. Projeçalışmaları 39 7 FTP FTP Projeçalışmalarınıöğrenir FTP FTP29.3. Projeçalışmaları 39 7 FTP FTP Projeçalışmalarınıöğrenir. Hafta-Tarih DersKonuları İlgili Program Yeterliği Eylül 29 UyumHaftası 2 3 Eylül 29 Gerontoloji, GeriatriVeYaşlanmaileilgilitanımlar PY2 PY3 3 7Ekim 29 Yaşlanmailemeydanagelenfizyolojikdeğişiklikler PY2 PY3 4 4 Ekim 29 Kas- iskeletsistemindeyaşlanmailemeydanagelenfizyolojikdeğişiklikler- PY4 Projeçalışması 2 Ekim 29 Sinirsistemindeyaşlanmailemeydanagelenfizyolojikdeğişiklikler - Projeçalışması PY Ekim 29 Kardiyopulmonersistemdeyaşlanmailemeydanagelenfizyolojikdeği şiklikler- Projeçalışması PY 7 4Kasım 29 Yaşlanmaileortayaçıkanduyu-algı-motor değişiklikler PY2 PY 9-7 Kasım 29 Ara Sınav 8 8Kasım 29 Fonksiyoneldeğerlendirmeyöntemlerivedüşmeler PY2 PY3 9 2Kasım 29 Geriatridemultidisiplinerekipçalışmasınınönemi PY4 PY6 2Aralık 29 Yaşlılarauygunegzersizprogramları PY4 PY6 9Aralık 29 Sağlıklıyaşlanmaveyaşamkalitesi PY 2 6Aralık 29 Yaşlılıktafizyoterapiyeyönelikçalışmaalanları PY 3 23Aralık 29 Projesunumları PY PY2 4 3 Aralık 29 Projesunumları PY PY2 4-2 Ocak 22 DönemSonuSınavı 2-26 Ocak 22 BütünlemeSınavı Bu dersindeğerlendirmesi, Değerlendirme kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu 39

140 üzerinden 6 tır. Örneksorular.)Aşağıdakilerdenhangisisağlıklıbireylerleçalışanbirfizyoterapistingörevalanıdışınd adır? A) Bireylerekoruyucu vitamin veilaç tavsiyelerindebulunmak B) Bireyeözelfizikselaktiviteveegzersiz prog- ramlarınıplanlamakveuygulamak C) Bireylerinfizikselaktivitelerinidüzenlemek D) Bireylerinhareketkabiliyetleriniartırmak 2.)Aşağıdakilerdenhangisirehabilitasyonhizmetlerindegörevalanekipelemanlarındanb irideğildir? A) Fizyoterapist B) Psikolog C) Sağlıkmemuru D) Sosyalhizmetuzmanı 3.)Aşağıdakilerdenhangisiyatağabağımlı hastalardagelişenpsikolojikbozukluklardanbirideğildir? A) Kaygılarındaazalma B) Duygusalvesosyalizolasyon C) Yalnızlıkduygusu D) Ölümkorkusu CevapAnahtarı.A 2.C 3.A KaynakKitap Cassel, Christine; Riesenberg, Donald E.; Sorensen, Leif B.; Walsh, John R. "Geriatric medicine". NewYork, 99 Rossman, Isadore. "Clinical geriatrics", Philadelphia, 986. YardımcıKaynaklarve Okuma Listesi - FTP229 MESLEKİ YABANCI DİL I Öğretim Görevlisi Emrah ÇEVİK Oda Numarası E-posta Ders Zamanı Pazartesi Derslik Dersin Amacı Öğrencilere temel gramer yapılarını, ilgili konu anlatımları ve egzersizlerin yardımı ile öğretmek ve belirli bir düzeyde İngilizce okuma- anlama- yazma becerilerini geliştirmek. 4

141 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Konu ve ilgili kazanım 39 7 FTP FTP229.. Dersin ve yabancı dil olarak İngilizcenin tanımı 39 7 FTP FTP229.. Ders içeriği hakkında bilgi sahibi olur 39 7 FTP FTP İngilizce dilinin genel gramer yapısını tanır FTP FTP "Olmak fiilinin tüm öznelere göre çekimi, tekil ve çoğul kullanımları, Cümlenin Öğeleri, Sözcük dizimi 39 7 FTP FTP To be yardımcı fiilinin kullanımını ve önemini öğrenir FTP FTP Özne zamirleri ve diğer özneler ile to be fiilinin nasıl kullanıldığını öğrenir FTP FTP Cümenin öğelerini öğrenerek cümle kurma yeteneklerini pekiştirir FTP FTP Subject ve Object Pronouns (Özne ve Nesne Zamirleri ) 39 7 FTP FTP Özne zamirlerinin cümledeki anlamını ve kullanım yerlerini öğrenir. (i,you,he,she,it,we,you,they) 39 7 FTP FTP Nesne zamirlerinin cümledeki anlamını ve kullanım yerlerini öğrenir. (me,you,him,her,it,us,you,them) 39 7 FTP FTP Özne ve nesne zamirleri ile ilgili soru, olumlu ve olumsuz cümleler kurmayı öğrenir FTP FTP PossesiveAdjectives (iyelik sıfatları) ve PossesivePronouns (sahiplik zamirleri) 39 7 FTP FTP İyelik sıfatlarının cümledeki anlamını ve kullanım yerlerini öğrenir. (my,your,his,her,its,our,your,their) 39 7 FTP FTP Sahiplik zamirlerinin cümledeki anlamını ve kullanım yerlerini öğrenir. (mine,yours,his,hers,its,ours,yours,theirs) 39 7 FTP FTP İyelik sıfatları ve sahiplik zamirleri ile ilgili soru, olumlu ve olumsuz cümleler kurmayı öğrenir FTP FTP229.. ReflexsivePronouns (Dönüşlü Zamirler) ve Singular(Tekil) Plural (Çoğul) 39 7 FTP FTP Dönüşlü zamirlerin cümledeki anlamını ve kullanım yerlerini öğrenir. (myself, yourself, himself, herself, itself, ourselves, yourselves, theirselves) 39 7 FTP FTP Tekil ve çoğul kelimeler hakkında bilgi sahibi olur FTP FTP İşaret Zamirleri(demonstrativepronouns) ve there is, thereare kalıpları 39 7 FTP FTP İşaret zamirlerinin cümledeki anlamını ve kullanım yerlerini öğrenir. (this, that, those, these). Olumlu, olumsuz ve soru cümleleri kurmayı öğrenir FTP FTP Varlık, yokuluk belirten there is ve thereare kalıpları hakkında bilgi sahibi olur ve konu ile ilgili olumlu, olumsuz ve soru cümleleri kurmayı öğrenir FTP FTP Articles (a,an,the) ve Adjectives (sıfatlar) 39 7 FTP FTP Articles olarak adlarılan a, an, the kelimelerinin cümledeki 39 7 FTP FTP anlamını ve kullanım yerlerini öğrenir. Sıfatlarının cümledeki anlamını ve kullanım yerlerini öğrenir. Sıfatlar ile ilgili olumlu, olumsuz ve soru cümleleri kurmayı öğrenir FTP FTP PresentContinuous Tense (Şimdiki Zaman) 39 7 FTP FTP Şimdiki zamanda cümle kurmayı öğrenir FTP FTP Şimdiki zamanda kullandığımız zaman zarflarını öğrenir FTP FTP Simple Present Tense (Geniş Zaman) 39 7 FTP FTP Geniş zamanda cümle kurmayı öğrenir FTP FTP Geniş zamanda kullandığımız zaman zarflarını öğrenir FTP FTP229.. Comperatives ve Superlatives 39 7 FTP FTP Karşılaştırmada kullandığımız daha.. anlamına gelen 4

142 ekleri ve kelimeleri öğrenir FTP FTP en (sıfat) anlamına gelen ekleri ve kelimeleri öğrenir FTP FTP229.. So ve Such kullanımı 39 7 FTP FTP Sıfatlarla beraber kullandığımız so ve such kelimelerini öğrenir FTP FTP Too ve Enough kullanımı 39 7 FTP FTP Aşırılık anlamına gelen too kelimesinin zarf ve sıfatlarla kullanımını öğrenir FTP FTP Yeterince anlamına gelen enough kelimesinin zarf ve sıfatlarla kullanımını öğrenir FTP FTP Quite ve Rather Bayağı, epey anlamına gelen quite ve rather 39 7 FTP FTP kelimelerinin olumlu ve olumsuz anlamlarda nasıl kullanıldığı hakkında bilgi sahibi olur FTP FTP Soru Kelimeleri (QuestionWords) 39 7 FTP FTP Sorularda kullandığımız kelimeleri öğrenir (when,whar,which, where,why, who, whose, how,..) Hafta-Tarih Ders Konuları İlgili Program Yeterliği Eylül 29 Uyum haftası 2 4 Ekim 29 "Olmak fiilinin tüm öznelere göre çekimi, tekil ve çoğul PY-PY6 kullanımları, Cümlenin Öğeleri, Sözcük dizimi 3 Ekim 29 Subject ve Object Pronouns (Özne ve Nesne Zamirleri ) PY-PY6 4 8 Ekim 29 PossesiveAdjectives (iyelik sıfatları) ve PossesivePronouns PY-PY6 (sahiplik zamirleri) 2 Ekim 29 ReflexsivePronouns (Dönüşlü Zamirler) ve Singular(Tekil) Plural PY-PY6 (Çoğul) 6 Kasım 29 İşaret Zamirleri(demonstrativepronouns) ve there is, thereare PY-PY6 kalıpları 7 8 Kasım 29 Articles (a,an,the) ve Adjectives (sıfatlar) PY-PY6 9-7 Kasım 29 Ara Sınav 8 22 Kasım 29 PresentContinuous Tense (Şimdiki Zaman) PY-PY Kasım 29 Simple Present Tense (Geniş Zaman) PY-PY6 6 Aralık 29 Comperatives ve Superlatives PY-PY6 3 Aralık 29 So ve Such kullanımı PY-PY6 2 2 Aralık 29 Too ve Enough kullanımı PY-PY Aralık 29 Quite ve Rather PY-PY6 4 3 Ocak 22 Soru Kelimeleri (QuestionWords) PY-PY6 4-2 Ocak 22 Yarıyıl Sonu Sınavı 2-26 Ocak 22 Bütünleme Sınavı Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır.. He shortandfat. A) am B) isn t C) are D) has 2.My friendandi..students at thesameclass. A)is B) am C) are D) have 3. Is he at work? No, he. A)is B) are C) isn t D) aren t Örnek Sorular 4. I fromturkey. A)is B) am C) are D) have. How old you? A)is B) am C) are D) isn t 6. is a verygoodbook.(kitap) A)He B)They C)It D) I 7. gotothemosque (Ali and Cevdet) 42

143 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu A)She B) He C)They D)We 8. arecomingtotheclass (I and Cevdet) A)We B)They C) He D)It 9. I gave a gift (I gave a gift Cevdet>Cevdet ehediyealdım) A)He B)They C)Him D) His. like (I and Cevdet likeourfather) >(Ben ve Cevdet babamızı seviyoruz) A)We/His B)They/His C)We/Him D) He/His Cevap Anahtarı -b 2-c 3-c 4-b -c 6-c 7-c 8-a 9-c -c Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi Step by Step English Active English Grammer Step by Step English Active English Grammer Öğretim Elemanı Oda Numarası - E-posta Ders Zamanı - FTP23-ARAŞTIRMA YÖNTEM VE TEKNİKLERİ Alptekin DEVELİ Derslik - Dersin Amacı Bilimsel araştırmanın tanımı, önemi ve kapsamı ile bilimsel araştırma yöntemleri ve tekniklerini teorik ve pratik olarak öğretmektir. Konu ve ilgili kazanım 39 7 FTP FTP23.. Araştırma yöntemlerine giriş 39 7 FTP FTP23.. Araştırma ve bilim kavramlarını bilir FTP FTP23..2 Bilimsel araştırma kavramını ve kapsamını bilir FTP FTP23..3 Bilimsel araştırmaya olan ihtiyacın mantığını kavrar FTP FTP23.2. Araştırma yöntemlerinde temel kavramlar 39 7 FTP FTP Değişken kavramını ve türlerini bilir FTP FTP23.2. Hipotez, sayıltı, sınırlılık kavramlarını bilir FTP FTP Evren ve örneklemi bilir FTP FTP23.3. Araştırma yöntemlerinde temel kavramlar 39 7 FTP FTP Veri, desen, deney grubu ve kontrol grubunu bilir FTP FTP Güvenilirlik ve geçerliliği bilir FTP FTP Kuram ve tez kavramlarını bilir FTP FTP23.4. Bilimsel araştırma süreci 39 7 FTP FTP23.4. Bilimsel araştırmanın aşamalarını bilir. 43

144 39 7 FTP FTP23.4. Sorunsal belirleme ve kavramsallaştırmayı anlar FTP FTP Veri toplama, analiz ve raporlama sürecini anlar FTP FTP23.. Araştırma konusunun seçilmesi 39 7 FTP FTP23..3 Bilimsel araştırmada konu seçimini ve önemini bilir FTP FTP23..4 Araştırma probleminin belirlenmesindeki etkenleri bilir FTP FTP23.. Araştırma probleminin seçilmesi için gerekli kriterleri bilir FTP FTP23.6. Araştırma konusunun seçilmesi 39 7 FTP FTP Problem cümlesinin oluşturulmasını bilir FTP FTP Soru cümlesi oluşturma ve hipotez kurmayı anlar FTP FTP Hipotez türlerini bilir FTP FTP23.7. Araştırmanın amacı ve öneminin belirtilmesi 39 7 FTP FTP Bilimsel araştırma amaç ve önem ifadesinin yerini anlar FTP FTP Bilimsel araştırma bağlamında amacın özelliklerini bilir FTP FTP Bilimsel araştırma bağlamında önemlilik olgusunu anlar FTP FTP23.8. Bilimsel araştırmada evren ve örneklem 39 7 FTP FTP Örnekleme yoluyla veri toplamanın avantajlarını bilir FTP FTP Örnekleme yoluyla araştırma yapmanın sakıncalarını bilir FTP FTP Örnekleme sürecini ve yöntemlerini anlar FTP FTP23.9. Kaynak araştırması yapma 39 7 FTP FTP Kaynak araştırması bağlamında yöntem kavramını anlar FTP FTP Bilimsel araştırmanın amaçlarını anlar FTP FTP Kaynak araştırması bağlamında yöntem türlerini bilir FTP FTP23.. Kaynak araştırması yapma 39 7 FTP FTP Kaynak araştırması bağlamında yöntem kavramını anlar FTP FTP Kaynak araştırması bağlamında teknik türlerini bilir FTP FTP23..3 Deneysel araştırmalarda kullanılan teknikleri anlar FTP FTP23.. Bilimsel araştırmada veri ve raporlama 39 7 FTP FTP23..3 Veri türlerini ve veri kaynaklarını anlar FTP FTP Veri toplamada kullanılan teknikleri anlar FTP FTP Yazın taramasının nasıl yapıldığını ve raporlandığını bilir FTP FTP23.2. SPSS paket programı tanıtımı 39 7 FTP FTP İstatistik paket programlarının ne amaçla kullanıldığını bilir FTP FTP SPSS paket programının veri ara yüzünü tanır FTP FTP SPSS paket programının değişken ara yüzünü tanır FTP FTP23.3. SPSS paket programı tanıtımı 39 7 FTP FTP SPSS paket programının temel butonlarını tanır FTP FTP SPSS paket programına veri girişinin nasıl yapıldığını anlar FTP FTP SPSS paket programında hangi tür analizler yapıldığını bilir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği Eylül 29 Uyum Haftası Ekim 29 Araştırma yöntemlerine giriş PY7 3 9 Ekim 29 Araştırma yöntemlerinde temel kavramlar PY7 4 6 Ekim 29 Araştırma yöntemlerinde temel kavramlar PY7 23 Ekim 29 Bilimsel araştırma süreci PY7 6 3 Ekim 29 Araştırma konusunun seçilmesi PY7 7 6 Kasım 29 Araştırma konusunun seçilmesi PY7 9-7 Kasım 29 Araştırmanın amaçları ve öneminin belirtilmesi PY-PY7 8 2 Kasım 29 ARA SINAV Kasım 29 Bilimsel araştırmada evren ve örneklem PY7 4 Aralık 29 Kaynak araştırması yapma PY3 Aralık 29 Kaynak araştırması yapma PY3 2 8 Aralık 29 Bilimsel araştırmada veri ve raporlama PY6 44

145 3 2 Aralık 29 SPSS paket programı tanıtımı PY8-PY Aralık 29 SPSS paket programı tanıtımı PY8-PY2 4-2 Ocak 22 Dönem Sonu Sınavları Ocak 22 Bütünleme Sınavları - Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar Değerlendirme çerçevesinde,karma yöntemle hazırlanmış (çoktan seçmeli, doğru-yanlış, klasik)bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı %4 finalinki ise %6 tır. Geçme notu üzerinden 6 tır.. Araştırma sorularını cevaplamak amacıyla bağımlı ve bağımsız değişkenlerin seçilmesi ve ölçümü için plan geliştirilmesidir. Yukarıdaki tanım cümlesi aşağıdaki terimlerden hangisini açıklamak üzere yapılmış olabilir? A-) KuramB-) Evren C-) Değişken D-) Sınırlılık E-) Desen Örnek Sorular Cevap Anahtarı 2. Olgusal veriler, subjektif (öznel) olan ve hakkında yorum yapmayı gerektiren verilerdir. İnsanların görüş ve düşüncelerine, tutum ve davranışlarına dayalı olarak oluşur. A-) Doğru B-) Yanlış 3. Birincil veriler nedir? Açıklayınız. Birincil verilerin elde edilmesinde kullanılan tekniklerin isimlerini yazınız. -) E 2-) B 3-) Birincil veriler orijinaldir. Yani araştırmacı tarafından oluşturulmuştur. Bilimsel bilgiye ulaşmada daha çok birincil verilerden faydalanılır. Esasında bilimsel bilginin değeri birincil veri kaynakları ile elde edilmesinde bağlıdır.birincil verilerin elde edilmesinde kullanılan teknikler: Anket, gözlem, deney, görüşme (mülakat) tır. Editör: Zeki KAYA & Mehmet Şahin Kaynak Kitap Araştırma Yöntemleri ve Teknikleri, 2. Baskı, Eğitim Yayınevi FTP-29 KİNEZYOLOJİ Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Özellikle egzersiz tedavisi sırasında uygulayacağı eksternal kuvvetin veya germenin dokular üzerindeki etkilerini bilmek, fizyoterapi-rehabilitasyon uygulamalarını yapmak; kinetik ve kinematik analizlerin nasıl yapıldığını k, normal yürüyüşün değerlerini ve patolojik yürüyüşün alt gruplarını, yürüyüş problemlerini 4

146 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu ve kompansasyon mekanizmalarını öğrenerek bu bilgileri değerlendirmek, tedaviye yönelik olarak ve araştırma tasarımında kullanmaktır. Mekanik prensipler ile fizyoterapi-rehabilitasyon yaklaşımlarını nasıl birleştirebileceğini k, araştırma planlama ve yürütme becerisi kazanmaktır. Vücut kısımlarının hareket özelliklerini ve hareket sırasındaki ilişkileri anlamak. dizilim hatalarını saptamak. Mekanik prensipler ile fizyoterapi-rehabilitasyon yaklaşımlarını nasıl birleştirebileceğini k, araştırma planlama ve yürütme becerisi kazanmaktır. Konu ve ilgili kazanım 39 7 FTP FTP29.. Normal Yürüyüşün Tanımı.Normal Yürüyüşün Belirleyicileri FTP FTP29.. Hareket açısından temel yapıları tanımlar FTP FTP29..2 Hareket analizlerini tanımlar 39 7 FTP FTP29.2. Yürüyüşün Değerlendirilmesi. Yürüyüşün Değerlendirilmesi 39 7 FTP FTP Yürüme analizi uygular 39 7 FTP FTP Yürüme analizi sonuçlarını yorumlar 39 7 FTP FTP29.3. Patolojik Yürüyüş. Huduttaki Yürüyüş 39 7 FTP FTP29.3. Patalojik yürüyüşleri bilir 39 7 FTP FTP Huduttaki yürüyüşleri bilir 39 7 FTP FTP Kemiklerin Yapısı.Kemikler Üzerine Etki Eden Kuvvetler 39 7 FTP FTP Kemklerin yapısını bilir 39 7 FTP FTP Üzerine binen yükleri bilir 39 7 FTP FTP29.. Kas, tendon ve ligamentler 39 7 FTP FTP29..9 Kas, tendon ve ligamentlerin yapılarını bilir 39 7 FTP FTP Eklemlerin Sınıflaması.Kaldıraç Sistemleri 39 7 FTP FTP Eklemleirn yapılarını bilir, sınıflar FTP FTP Kaldıraç sistemini eklemler üzerinde ayırt eder FTP FTP Omuz Kol-Kompleksi 39 7 FTP FTP Omuz yapısını bilir 39 7 FTP FTP Kol yapısını bilir 39 7 FTP FTP Dirsek Eklemi 39 7 FTP FTP Dirsek eklemi yapısını bilir 39 7 FTP FTP El-El Bileği 39 7 FTP FTP El- el bileğini oluşturan yapıları bilir FTP FTP29.. KolumnaVertebralis 39 7 FTP FTP29..6 Omurgayı oluşturan yapıları bilir 39 7 FTP FTP29.. Pelvis 39 7 FTP FTP29..7 Kalça bölgesini oluşturan yapıları bilir FTP FTP Diz Eklemi 39 7 FTP FTP Diz eklemini oluşturan yapıları bilir 39 7 FTP FTP Ayak-Ayak Bileği 39 7 FTP FTP Ayak- ayak bileği eklemini oluşrutan yapıları bilir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği Eylül 29 Uyum haftası PY 2 3 Eylül 29 Normal Yürüyüşün Tanımı. Normal Yürüyüşün Belirleyicileri.. PY3-PY4 3 7 Ekim 29 Yürüyüşün Değerlendirilmesi. Yürüyüşün Değerlendirilmesi PY3-PY4 4 4 Ekim 29 Patolojik Yürüyüş. Huduttaki Yürüyüş PY3-PY4 2 Ekim 29 Kemiklerin Yapısı.Kemikler Üzerine Etki Eden Kuvvetler PY3-PY Ekim 29 Kas, tendon ve ligamentler PY3-PY4 7 4 Kasım 29 Eklemlerin Sınıflaması.Kaldıraç Sistemleri PY3-PY4 9-7 Kasım 29 Ara Sınav 46

147 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu 8 8 Kasım 29 Omuz Kol-Kompleksi PY3-PY4 9 2 Kasım 29 Dirsek Eklemi PY3-PY4 2 Aralık 29 El-El Bileği PY3-PY4 9 Aralık 29 KolumnaVertebralis PY3-PY4 2 6 Aralık 29 Pelvis PY3-PY Aralık 29 Diz Eklemi PY3-PY4 4 3 Aralık 29 Ayak-Ayak Bileği PY3-PY4 4-2 Ocak 22 Yarıyıl sonu sınavları 2-26 Ocak 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli, Klasikve D/Ybir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır.. Vücut ağırlık merkezi, vücut ağırlığının eşit olarak dağıldığı bir denge noktasıdır? Örnek Sorular 2. Menisküslerin görevlerini yazınız? 3. Aşağıdakilerden hangisi el tarak kemiğine verilen isimdir? a- Humerus b- femur c- costa d- metecarpal e- radius - Doğru Cevap Anahtarı 2- Eklem yüzü uyumu,şoklarıabsorbe etme, Friksiyonu azaltma, Lubrikasyonu sağlama 3 D Kaynak Kitap Burstein AH, Wright TM. Fundamentals of orthopedicbiomechanics. William&Wilkins, Baltimore, 994. Yardımcı Kaynaklar ve Okuma Listesi Frankel VH, Nordin M. Basics biomechanics of theskeletalsystem. Lea&Febiger, Phildelphia, 98. FTP-22 MASAJ Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Fizik tedavi teknikerinin hizmet sunduğu sağlık kuruluşunda, doktorun ve fizyoterapistin düzenlediği masaj tedavi programını uygulayabilmesi amaçlanmaktadır. Konu ve ilgili kazanım 39 7 FTP FTP22.. Masajın tanımı ve tarihsel gelişimi 39 7 FTP FTP22.. Masajın tanımını bilecektir 39 7 FTP FTP22..2 Masajı tarihsel gelişimini bilecektir FTP FTP22.2. Masajın Etkileri 39 7 FTP FTP Masajın mekanik ve fizyolojik etkilerini açıklayabilecektir Masajın kullanım alanları,endikasyonları ve 39 7 FTP FTP22.3. kontraendıkasyonları 39 7 FTP Klasik masajın endikasyon ve 39.7.FTP kontraendikasyonlarınıaçıklayabilecektir. 47

148 39 7 FTP22 4 Masaj uygulamasında genel 39.7.FTP22.4. prensipler,vücutmekanikleri,masajekipmanları,tedavi ortamı 39 7 FTP FTP22.4. Masaj uygulamasında genel prensipleri sıralayabilecektir 39 7 FTP FTP22..6 Masaj uygulamasında vücut mekaniğini, ekipmanları bilecektir 39 7 FTP FTP Masaj uygumla esnasında tedavi ortamını bilecektir FTP FTP22.. Klasik masaj teknikleri ve masaj hareketleri 39 7 FTP FTP22..8 Klasik masaj tekniklerini uygulayabilecektir FTP FTP22..9 Klasik masaj hareketlerini bilecektir 39 7 FTP FTP22.6. Uyluk masajı 39 7 FTP FTP22.6. Uyluk bölgesi masajını bilecektir FTP FTP22.7. Alt bacak masajı 39 7 FTP FTP22.7. Alt bacak bölgesi masajını bilecektir FTP FTP22.8. Ayak-Ayak bileği masajı 39 7 FTP FTP Ayak- ayak bileği bölgesi masajını bilecektir FTP FTP22.9. Üst ekstremite masajı 39 7 FTP FTP Üst ekstremite masajını bilecektir FTP FTP22.. El-el bileği masajı 39 7 FTP FTP22..4 El- el bileği bölgesi masajını bilecektir FTP FTP22.. Sırt masajı 39 7 FTP FTP22.. Sırt bölgesi masajını bilecektir FTP FTP22.2. Karın masajı 39 7 FTP FTP Karın bölgesi masajını bilecektir FTP FTP22.3. Yüz bölgesi masajı 39 7 FTP FTP Yüz bölgesi masajını bilecektir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği 23-27EYLÜL 29 Uyum haftası PY 2 EKİM 29 Masajın tanımı ve tarihsel gelişimi PY4-PY6 3 8 EKİM 29 Masajın Etkileri PY4-PY6 4 EKİM 29 Masajın kullanım alanları,endikasyonları ve kontraendıkasyonları PY4-PY6 22 EKİM 29 Masaj uygulamasında genel prensipler,vücutmekanikleri,masajekipmanları,tedavi ortamı PY4-PY EKİM 29 Klasik masaj teknikleri ve masaj hareketleri PY4-PY6 7 KASIM 29 Uyluk masajı PY4-PY6 9-7 Kasım 29 Ara Sınav 8 9 KASIM 29 Alt bacak masajı PY4-PY KASIM 29 Ayak-Ayak bileği masajı PY4-PY6 3 ARALIK 29 Üst ekstremite masajı PY4-PY6 ARALIK 29 El-el bileği masajı PY4-PY6 2 7 ARALIK 29 Sırt masajı PY4-PY6 3 2 ARALIK 29 Karın masajı PY4-PY6 4 3 ARALIK 29 Yüz bölgesi masajı PY4-PY6 4-2 Ocak 22 Yarıyıl sonu sınavları 2-26 Ocak 22 Bütünleme sınavları Değerlendirme Örnek Sorular Cevap Anahtarı Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas alınarak hazırlanacak olan uygulama bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. - kalsik el masajını göseriniz? 2- Klasik bacak masajını gösteriniz? 3- Kalsik boyun masajını gösterini? Tüm uygulamalarda masaj yönü, başlama şekli, hasta ile iletişim, masaj şekilleri, uygulama yeteneği ve bitiriş esas alınacaktır. Bütün hepsini yapan öğrenci tam not alır. 48

149 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi Prof. Dr. İnci Yüksel. Masaj Teknikleri. Seçkin Kitabevi, 23.Prof. Dr. İnci Yüksel, Masaj teknikleri, alp yayınevi, sayfa: -2 FTP-227 İŞ VE UĞRAŞI Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı İş ve uğraşı değerlendirme yöntemlerini tanımlamak, uygun iş ve uğraşı yaklaşımlarının geliştirilebilmesi konusunda temel bilgiler ve uygulama becerisi kazandırılması amaçlanmıştır. Konu ve ilgili kazanım 39 7 FTP FTP227.. Ergoterapinin tarihçesi ve gelişimi 39 7 FTP FTP227.. Ergoterapinin tarihi ve gelişimi hakknda bilgi sahibi olur FTP FTP Günlük Yaşam Aktiviteleri Değerlendirilmesi ve Pratik Uygulamalar 39 7 FTP FTP Günlük yaşamı değerlendirme ve gözlemlemeyi öğrenir FTP FTP Hemiplejide İş Uğraşı Tedavisi 39 7 FTP FTP hemiplejik hastalarda iş uğraş terapisi hakkında bilgi sahibi olur FTP FTP Alt Motor Nöron Lezyonlarında İş Uğraşı Tedavisi 39 7 FTP FTP Alt motor nöron lezyon seviyelerini ve çeşitlerini bilir 39 7 FTP FTP Alt motor nöron lezyonlarında iş uğraşı terapisi hakknda bilgi sahibi olur FTP FTP227.. Transfer Aktivitelerinde Pratik Uygulama 39 7 FTP FTP Transfer aktivitelerini bilir 39 7 FTP FTP Transfer Aktivitelerinde Pratik Uygulama 39 7 FTP FTP Transfer aktivitelerini bilir FTP FTP Duyu Değerlendirmesi 39 7 FTP FTP Duyuları ayırt eder FTP FTP Duyu değerlendirmesi yapar 39 7 FTP FTP Duyu Algı Motor Bütünlüğü Eğitimi 39 7 FTP FTP Duyu algı motor bütünlüğü hakkında bilgi sahibi olur FTP FTP Çeşitli Hastalık Gruplarında iş uğraşı terapisi 39 7 FTP FTP Çeşitli hastalılarda iş uğraşı terapisi hakkında bilgi sahibi olur FTP FTP227.. Kognitif Rehabilitasyon 39 7 FTP FTP Kognitif rehabilitasyon hakkında bilgi sahibi olur FTP FTP227.. İş ve Uğraşı Tedavisinde El Eğitimi 49

150 39 7 FTP FTP El anatomi ve biyomekaniğini bilir FTP FTP El bölgesinde iş uğraşı terapisi hakkında bilgi sahibi olur 39 7 FTP FTP Farklı Yaş Gruplarında İş ve Uğraşı Tedavisi 39 7 FTP FTP Farklı yaş gruplarında iş uğraşı terapisi hakkında bilgi sahibi olur FTP FTP Genel Tekrar 39 7 FTP FTP Tüm konuları genel tekrar eder. Hafta-Tarih Ders Konuları İlgili Program Yeterliği 23-27EYLÜL 29 Uyum Haftası PY 2 3 EYLÜL 29 Fonksiyonel lık İçin Hareket Analizi PY3-PY4-PY9 3 7 EKİM 29 Günlük Yaşam Aktiviteleri Değerlendirilmesi ve Pratik Uygulamalar PY3-PY4-PY9 4 4 EKİM 29 Hemiplejide İş Uğraşı Tedavisi PY3-PY4-PY9 2 EKİM 29 Alt Motor Nöron Lezyonlarında İş Uğraşı Tedavisi PY3-PY4-PY EKİM 29 Transfer Aktivitelerinde Pratik Uygulama PY3-PY4-PY9 7 4 KASIM 29 Transfer Aktivitelerinde Pratik Uygulama PY3-PY4-PY9 9-7 Kasım 29 Ara sınav 8 8 KASIM 29 Duyu Değerlendirmesi PY3-PY4-PY9 9 2 KASIM 29 Duyu Algı Motor Bütünlüğü Eğitimi PY3-PY4-PY9 2 ARALIK 29 Kognitif Rehabilitasyon PY3-PY4-PY9 9 ARALIK 29 Kognitif Rehabilitasyon PY3-PY4-PY9 2 6 ARALIK 29 İş ve Uğraşı Tedavisinde El Eğitimi PY3-PY4-PY9 3 2 ARALIK 29 Farklı Yaş Gruplarında İş ve Uğraşı Tedavisi PY3-PY4-PY9 4 3 ARALIK 29 Genel Tekrar PY3-PY4-PY9 4-2 Ocak 22 Yarıyıl sonu sınavları 2-26 Ocak 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli, klasik, boşluk doldurma ve D/Y bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. - Paraplji nedir? Örnek Sorular 2- El tarak kemiklerine metetarsal kemikler denir? 3- Aşagıdakilerden hangisi C8 lezyonlarında görülmez? a- Oturma dengesi b- dirsek eklemi c- omuz d- el bileği e- boyun - Vücudun belden aşağısının felç olma durumudur. Cevap Anahtarı 2- Yanlış 3- A Kaynak Kitap H. Kayıhan Hemipleji de İş ve Uğraşı Tedavisi, H.Ü. Fizik Tedavi Rehabilitasyon Yardımcı Kaynaklar ve Okuma Listesi Y.O. Yayınları 23, Ankara 999. H. Kayıhan, N. Kırdı, M. Uyanık, Tülin Düger, G. Hazar. SerebralParalizili Çocuk ve Yaşam H. H.Ü. Fizik Tedavi Rehabilitasyon Y.O. Yayınları, Ankara 99. Öğretim Üyesi FTP23 İLETİŞİM DARICI Oda Numarası 2 E-posta Ders Zamanı Pazartesi : 7: Derslik EDZ-3

151 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Dersin Amacı Öğrencilerin ilk çağlarda iletişimin ortaya çıkışı ve gelişimi, Sosyal gelişmelere paralel olarak iletişimin gelişmesi ve çeşitlenmesi, İletişim nedir? İnsanlar niçin iletişim kurar? Doğrusal İletişim Modeli, İletişimin Faktörleri konusunda bilgi sahibi olmalarını sağlamak. Konu ve ilgili kazanım 39 7 FTP FTP23.. İletişime Dair Genel Bilgiler 39 7 FTP FTP23.. İletişime dair genel kavramları bilir FTP FTP23..2 İiletişime dair kavramları tanımlayabilir FTP FTP23..3 İletişime dair kavramları açıklayabilir FTP FTP23.2. İletişimin Kullanım Alanları 39 7 FTP FTP İletişim kullanım alanlarını bilir FTP FTP23.2. İletişim kullanım alanlarını açıklayabilir FTP FTP İletişim kullanım alanlarını örnekleyebilir FTP FTP23.3. İletişimin Öğeleri 39 7 FTP FTP iletişimin öğelerini bilir FTP FTP İletişimin öğelerini sayabilir FTP FTP İletişimin öğelerini açıklayabilir FTP FTP23.4. Kitle İletişim Araçları 39 7 FTP FTP23.4. Kitle iletişimi kavramını bilir FTP FTP23.4. Kitle iletişim araçlarını bilir FTP FTP Kitle iletişim araçlarını açıklayailir FTP FTP23.. Yeni Medya Kitle İletişim Araçları 39 7 FTP FTP23..3 Yeni medya kavramını bilir FTP FTP23..4 Yeni medya kitle iletişimini bilir FTP FTP23.. Yeni medya kitle iletişim araçlarını açıklayabilir FTP FTP23.6. Sözlü İletişim; Yazılı iletişim; Görsel İletişim 39 7 FTP FTP Sözlü iletişim kavramını bilir FTP FTP Sözlü iletişim kavramını açıklayabilir FTP FTP Yazılı iletişim kavramını bilir FTP FTP23.7. Sözlü İletişim; Yazılı iletişim; Görsel İletişim 39 7 FTP FTP Yazılı iletişim kavramını açıklayabilir FTP FTP Görsel iletişim kavramını bilir FTP FTP Görsel iletişim kavramını açıklayabilir FTP FTP23.8. Yaratıcı İletişim Teori ve Örnekleri 39 7 FTP FTP Yaratıcı iletişim kavramını bilir FTP FTP Yaratıcı iletişim teorilerini bilir FTP FTP Yaratıcı iletişim teori ve örneklerini açıklayabilir FTP FTP23.9. Yaratıcı İletişim Teori ve Örnekleri 39 7 FTP FTP Yaratıcı iletişim kavramını bilir FTP FTP Yaratıcı iletişim teorilerini bilir FTP FTP Yaratıcı iletişim teori ve örneklerini açıklayabilir FTP FTP23.. Yaratıcı İletişim Uygulamaları 39 7 FTP FTP Yaratıcı iletişim uygulamaları gösterebilir FTP FTP Yaratıcı iletişimin ilkelerini bilir FTP FTP23..3 Yaratıcı iletişimin yararlarını bilir FTP FTP23.. Okuma ve Dinleme Pratikleri 39 7 FTP FTP23..3 Okuma pratikleri yapabilir FTP FTP Dinleme pratikleri yapabilir FTP FTP Okuma ve Dinlenme pratikleri yapabilir FTP FTP23.2. Bireysel Sunum Pratikleri

152 39 7 FTP FTP Bireysel sunum hazırlayabilir FTP FTP Bireysel sunum yapabilir FTP FTP Bireysel sunum pratiği elde eder FTP FTP23.3. Grup Sunum Pratikleri 39 7 FTP FTP Grup halinde sunum hazırlayabilir FTP FTP Grup halinde sunum yapabilir FTP FTP Grup halinde sunum pratiği elde eder. Hafta-Tarih Ders Konuları İlgili Program Yeterliği 23-27eylül 29 Uyum Haftası - 2 Ekim 29 İletişime Dair Genel Bilgiler PY 3 8 Ekim 29 İletişimin Kullanım Alanları PY-PY 4 Ekim 29 İletişimin Öğeleri PY-PY 22 Ekim 29 Kitle İletişim Araçları PY-PY 6 29 Ekim 29 Yeni Medya Kitle İletişim Araçları PY-PY 7 Kasım 29 Sözlü İletişim; Yazılı iletişim; Görsel İletişim PY-PY 9-7 Kasım 29 Sözlü İletişim; Yazılı iletişim; Görsel İletişim PY-PY 8 9 Kasım 29 ARA SINAV 9 26 Kasım 29 Yaratıcı İletişim Teori ve Örnekleri PY-PY 3 Aralık 29 Yaratıcı İletişim Teori ve Örnekleri PY-PY Aralık 29 Yaratıcı İletişim Uygulamaları PY-PY 2 7 Aralık 29 Okuma ve Dinleme Pratikleri PY-PY2 3 2 Aralık 29 Bireysel Sunum Pratikleri PY-PY2 4 3 Aralık 29 Grup Sunum Pratikleri PY-PY Dönem Sonu Sınavları Bütünleme Sınavları Değerlendirme Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas alınarak hazırlanacak olan çoktan seçmeli bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. -)Bir insanın, kendisini karşısındaki insanın yerine koyarak onun duygularını ve düşüncelerini doğru olarak anlaması aşağıdaki kavramlardan hangisini açıklamaktadır? A-) Dinleme B-) Psikoloji C-) Sempati D-) Empati E-) İletişim Örnek Sorular Cevap Anahtarı 2. Duyu organlarımızdan beynimize ulaşan verilerin örgütlenmesi, yorumlanması ve anlamlandırılmasıdır açıklaması aşağıdaki kavramlardan hangisini tanımlamaktadır? A-) İletişim B-) Psikoloji C-) Önyargı D-) Endişe E-) Algı 3.Aşağıdakilerden hangisi beden dilinin öğeleri arasında yer almamaktadır? A-) Jest ve Mimikler B-) Ses Tonu C-) Renklerin Dili D-) Sözcükler E-) Giyim kuşam kodu -) D 2-) A 3-) D 2

153 D e Okul Program Ders Konu Kazanım Kodu Kaynak Kitap Yazar/Editör: Demet Gürüz,Ayşen Temel Eğinli İletişim Becerileri Anlamak Anlatmak Anlaşmak. Basın Nobel Yayınları, Ankara 26. Melek SARI Y A Z A R 2.SINIF BAHAR DÖNEMİ DERS PLANLARI ÖğretimÜyesi Oda Numarası E-posta DersZamanı Derslik DersinAmacı FTP 22-HİDROTERAPİ VE BALNEOTERAPİ Bir tedaviaracıolaraksuyunveçamurunkullanımınık, suveçamurilegelentedaviyik. Konuveilgilikazanım 39 7 FTP FTP22.. Genelkavramlarvetanımlar 39 7 FTP FTP22.. Hidroterapiyitanımlar FTP FTP22..2 Hidroterapideuygulananyöntemleritanımlar FTP FTP22.2. Hidroterapidefizyolojikkavramlar 39 7 FTP FTP Hidroterapininfizyolojiketkilerinibilir FTP FTP22.3. Hidroterapideuygulamayöntemleriveçeşitleri 39 7 FTP FTP Hidroterapiuygulamayöntemlerinitanımlar FTP FTP22.4. Hidroterapideuygulamayöntemleriveçeşitleri 39 7 FTP FTP22.4. Hidroterapiyöntemleriniuygular FTP FTP22.. Fluidoterapi 39 7 FTP FTP22..6 Fluidoterapiyitanımlarveuygular FTP FTP22.6. Girdapbanyoları 39 7 FTP FTP Girdapbanyolarınıtanımlar FTP FTP Banyonun Teknik özelliklerinibilir FTP FTP22.7. Girdapbanyoları 39 7 FTP FTP Girdapbanyolarınıuygulamayöntemlerinibilir FTP FTP22.8. Kelebekbanyoları 39 7 FTP FTP22.8. Kelebekbanyolarınınözelliklerinibilirveuygulamasınıyapabilir FTP FTP22.9. Balneoterapi 39 7 FTP FTP22.9. Balneoterapi Teknik özelliklerinibilir FTP FTP22.. Balneoterapi 39 7 FTP FTP22..2 Balneoterapiuygulamasınıyapabilir. 3

154 39 7 FTP FTP22.. Kaplıcalarveözellikleri 39 7 FTP FTP22..3 Kaplıcatedavisinitarifedebilir,uygulayabilir FTP FTP22.2. Kaplıcalarveözellikleri 39 7 FTP FTP Hidroterapiyöntemleriniuygular 39 7 FTP FTP22.3. Kaplıcalarveözellikleri 39 7 FTP FTP22.3. Hidroterapiyöntemleriniuygular Hafta-Tarih DersKonuları İlgili Program Yeterliği -4Şubat 22 UyumHaftası 2 7-2Şubat 22 Genelkavramlarvetanımlamalar PY PY Şubat22 Hidroterapidefizyolojikkavramlar PY Mart 22 Hidroterapideuygulamayöntemleriveçeşitleri PY3 PY4 9-3 Mart 22 Hidroterapideuygulamayöntemleriveçeşitleri PY3 PY Mart 22 Fluidoterapi PY Mart 22 Girdapbanyoları PY3 PY4 28 Mart- Nisan 22 Ara sınav 8 6- Nisan 22 Girdapbanyoları PY3 PY Nisan 22 Kelebekbanyoları PY Nisan 22 Balneoterapi PY6 PY7 27 Nisan-Mayıs22 Balneoterapi PY6 PY Mayıs22 Kaplıcalarveözellikleri PY3 PY4 PY6 PY7 3 -Mayıs22 Kaplıcalarveözellikleri PY3 PY4 PY6 PY Mayıs 22 Kaplıcalarveözellikleri PY3 PY4 PY6 PY7 3 Mayıs-7Haziran22 DönemSonuSınavı -2 Haziran 22 BütünlemeSınavı Değerlendirme Örneksorular Bu dersindeğerlendirmesi, kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır..)aşağıdakilerdenhangisibalneoterapiyöntemlerindenbiridir? A) Talassoterapi B) Helioterapi C) Fitoterapi D) Algterapi E) Peloidoterapi 2.)Aşağıdakilerdenhangisigirdapbanyolarınınözelliklerindendeğildir? A)Hızla sirkülasyonu sağlanan suyun içine ekstremitelerin batırıldığı lokal banyolardır. B)Banyo kenarına tespit edilmiş su basınç cihazı= jet bulunur. C)Jet banyo içindeki suyu alıp yine banyo içine basınçla verir. D) Tüm geriatric hastalardakullanılabilir. 3.)Aşağıdakilerdenhangisihidroterapiekipmanlarındandeğildir? A)Traksiyoncihazı B)Havuz merdiveni C)Hasta taşıyıcı (LIFTER) D)Suiçiparalel bar CevapAnahtarı.E2.D 3.A 4

155 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu KaynakKitap H. Kayıhan, IsıIşıkdersnotları C. Algun, FizyoterapiveRehabilitasyon, Nobel TıpKitabevi, 2 YardımcıKaynaklarve Okuma Listesi - FTP-22 ELEKTROTERAPİ Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Alçak ve yüksek frekanslı akımların farklı patolojik durumlarda kullanılması ile ilgili yöntemler incelenecektir. Konu ve ilgili kazanım 39 7 FTP FTP22.. Giriş, dersin içeriği ve uygulama teknikleri hakkında genel bilgi 39 7 FTP FTP22.. Elektroterapi dersinin içeriğini öğrenir 39 7 FTP FTP22..2 Uygulamalar hakkında genel bilgi edinir FTP FTP22.2. Alçak ve Orta Frekanslı Akımların Özellikleri ve Sınıflandırılması 39 7 FTP FTP Alçak ve Orta Frekanslı Akımların Özelliklerini bilir 39 7 FTP FTP Alçak ve Orta Frekanslı Akımların Sınıflandırılması bilir FTP FTP22.3. Alçak Frekanslı Akımların Uygulama Yöntemleri 39 7 FTP FTP22.3. Alçak Frekanslı Akımları bilir FTP FTP Alçak Frekanslı Akımların Uygulama Yöntemlerini bilir FTP FTP22.4. Alçak ve Orta Frekanslı akımların Uygulama yöntemleri 39 7 FTP FTP Alçak ve Orta Frekanslı akımları bilir FTP FTP Alçak ve Orta Frekanslı akımların Uygulama yöntemlerini bilir FTP FTP22.. Orta Frekanslı akımların Uygulama yöntemleri 39 7 FTP FTP22..9 Orta Frekanslı akımları bilir 39 7 FTP FTP22.. Orta Frekanslı akımların Uygulama yöntemlerini bilir FTP FTP22.6. Yüksek Frekanslı Akımların Özellikleri ve Sınıflandırılması 39 7 FTP FTP22.6. Yüksek Frekanslı Akımların Özelliklerin bilir FTP FTP Yüksek Frekanslı Akımların Sınıflandırılmasını bilir FTP FTP22.7. Yüksek Frekanslı Akımların Uygulama Yöntemleri 39 7 FTP FTP Yüksek Frekanslı Akımları bilir.

156 39 7 FTP FTP Yüksek Frekanslı Akımların Uygulama Yöntemlerini bilir FTP FTP22.8. Yüksek Frekanslı Akımların Uygulama Yöntemleri 39 7 FTP FTP22.8. Yüksek Frekanslı Akımların Uygulama Yöntemlerini bilir FTP FTP22.9. Yüksek Frekanslı Akımların Uygulama Yöntemleri 39 7 FTP FTP Yüksek Frekanslı Akımların Uygulama Yöntemlerini bilir FTP FTP22.. Çeşitli hastalıklarda Alçak Frekanslı akımların kullanılması ile ilgili makale tartışmaları 39 7 FTP FTP22..7 Çeşitli makale tartışmaları ile konuyu kavrar FTP FTP22.. Çeşitli hastalıklarda Yüksek Frekanslı akımların kullanılması ile ilgili makale tartışmaları 39 7 FTP FTP22..8 Çeşitli makale tartışmaları ile konuyu kavrar FTP FTP22.2. Vaka tartışması 39 7 FTP FTP Vaka üzeri tartışma ile konuyu pekiştirir FTP FTP22.3. Vaka tartışması 39 7 FTP FTP Vaka üzeri tartışma ile konuyu pekiştirir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 Uyum Haftası PY Şubat 22 Giriş, dersin içeriği ve uygulama teknikleri hakkında genel bilgi PY3-PY4-PY Şubat 22 Alçak ve Orta Frekanslı Akımların Özellikleri ve Sınıflandırılması PY3-PY4-PY Mart 22 Alçak Frekanslı Akımların Uygulama Yöntemleri PY3-PY4-PY7 9-3 Mart 22 Alçak ve Orta Frekanslı akımların Uygulama yöntemleri PY3-PY4-PY Mart 22 Orta Frekanslı akımların Uygulama yöntemleri PY3-PY4-PY Mart 22 Yüksek Frekanslı Akımların Özellikleri ve Sınıflandırılması PY3-PY4-PY7 28 Mart- Nisan 22 Ara Sınav 8 6- Nisan 22 Yüksek Frekanslı Akımların Uygulama Yöntemleri PY3-PY4-PY Nisan 22 Yüksek Frekanslı Akımların Uygulama Yöntemleri PY3-PY4-PY Nisan 22 Yüksek Frekanslı Akımların Uygulama Yöntemleri PY3-PY4-PY7 27 Nisan- Mayıs 22 Çeşitli hastalıklarda Alçak Frekanslı akımların kullanılması ile ilgili makale tartışmaları PY3-PY4-PY Mayıs 22 Çeşitli hastalıklarda Yüksek Frekanslı akımların kullanılması ile ilgili makale tartışmaları PY3-PY4-PY7 3 - Mayıs 22 Vaka tartışması PY3-PY4-PY Mayıs 22 Vaka tartışması PY3-PY4-PY7 3 Mayıs -7 Haziran 22 Yarıyıl sonu sınavları -2 Haziran 22 Bütünleme sınavları Değerlendirme Örnek Sorular Cevap Anahtarı Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas alınarak hazırlanacak olan çoktan seçmeli, klasik ve boşluk doldurma bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. - Alçak frekaslı akımların fizyolojik etkilerini yazınız? 2- FTR de kullanılan US aletlerinde maksimum güç Watt ile sınırlandırılmıştır. 3- Biofeedback nedir? - Duyu sinirleri üzerine Motor sinirler üzerine Denerve kaslar üzerine -Kimyasal etkisi -Isı etkisi 2-3- Biyolojik ve otonom sinir sistemi tarafından otomatik olarak ayarlanan sistemlerin işitsel ve görsel sinyallerle bilinçli olarak kontrolü 6

157 D e Okul Program Ders Konu Kazanım Kodu Kaynak Kitap Kahn, Joseph "Principlesandpractice of electrotherapy" New York, 99. Shelia Kitchen "Electrotherapy :evidence-basedpractice"edinburg, 22. Yardımcı Kaynaklar ve Okuma Listesi John Low, AnnReed "Electrotherapyexplained :principlesandpractice" Oxford, 24. TheresaNalty."Electrotherapyclinicalproceduresmanual" New York, 2. Steven L. Wolf, "Electrotherapy" New York,98. FTP-28İLKYARDIM ÖğretimÜyesi Elif BAYAZIT Oda Numarası E-posta DersZamanı Derslik DersinAmacı Yaşamıtehlikeyedüşürenherhangibirdurumdasağlıkgörevlilerininyardımısağlanıncayakadar hayatınkurtarılmasıya da durumunkötüyegitmesiniönlemekamacıyla hasta/yaralıyaolayyerindemevcutaraçgereçleyapılangeçicibakımveilaçsızuygulamalarıöğret mektir. Konuveilgilikazanım 39 7 FTP FTP28.. İlk ve Acil Yardımın Tanımı, Temel İlkeleri, Amacı 39 7 FTP FTP28.. İlkyardım ve acil yardım kavramlarını tanımlar 39 7 FTP FTP28..2 Ilkyardımcıdabulunmasıgerekenözelliklerivegörevlerinibilir 39 7 FTP FTP28..3 Kan/solunumyoluylabulaştaalınacakkişiselkoruyucuönlemleribilir 39 7 FTP FTP28.2. Hastanın/yaralınındeğerlendirilmesi, KomaPozisyonu 39 7 FTP FTP Birincil değerlendirme basamaklarını (bilinç, solunum, dolaşım) açıklar 39 7 FTP FTP28.2. Ikincildeğerlendirmebasamaklarınıaçıklar 39 7 FTP FTP Yaşamsalbulguları, değerlendirmebasamaklarınıve normal değerlerinibilir 39 7 FTP FTP Hasta öyküsü alma vebaştanaşağıfizikselmuayenebasamaklarınıaçıklar 39 7 FTP FTP Komapoziyonununhangidurumdavenasılverileceğinibilir 39 7 FTP FTP28.3. Yetişkinlerde ve çocuklarda solunum yolu tıkanması 39 7 FTP FTP Yetişkinlerdekısmitıkanmadurumundayapılacakilkyardımgirişimleri nibilir 39 7 FTP FTP28.3. Yetişkinlerde tam tıkanmadurumundayapılacakilkyardımgirişimleriniaçıklar 39 7 FTP FTP28.3. Bebekveçocuktakısmitıkanmadurumundayapılacakilkyardımgirişiml erinibilir 7

158 39 7 FTP FTP Bebekveçocukta tam tıkanmadurumundayapılacakilkyardımgirişimleriniaçıklar 39 7 FTP FTP28.4. Solunumvedolaşımındurmasıvekalpakciğercanlandırılması (CPR) (yetişkin)/tyd 39 7 FTP FTP Yaşamkurtarmazinciribasamaklarınıbilir 39 7 FTP FTP Yetişkindebilinçdeğerlendirmesininnasılyapılacağını model üzerindeuygular 39 7 FTP FTP28.4. Yetişkindehavayoluaçmatekniklerini model üzerindeuygular 39 7 FTP FTP Yetişkindesolunumdeğerlendirmebasamaklarını(bak/dinle/hissetyön temi) model üzerindeuygular 39 7 FTP FTP Yetişkindekalpmasajı/sunisolunumuygulamatekniklerini model üzerindeuygular 39 7 FTP FTP28.. Solunumvedolaşımındurmasıvekalpakciğercanlandırılması (CPR) (bebekveçocukta)/tyd 39 7 FTP FTP28..8 Bebekveçocuktabilinçdeğerlendirmesininnasılyapılacağını model üzerindeuygular 39 7 FTP FTP28..9 Bebekveçocuktahavayoluaçmatekniklerini model üzerindeuygular 39 7 FTP FTP28..2 Bebekveçocuktasolunumdeğerlendirmebasamaklarını(bak/dinle/hiss etyöntemi) model üzerindeuygular 39 7 FTP FTP28..2 Bebekveçocuktakalpmasajı/sunisolunumuygulamatekniklerinimodel üzerindeuygular 39 7 FTP FTP28.6. Kanamalar, Şok ve Şok Tedavisi 39 7 FTP FTP Dış Kanamalarda İlk Yardım Uygulama basamaklarını bilir 39 7 FTP FTP Dış kanamalarda kanama durdurma yöntemlerini açıklar 39 7 FTP FTP Turnikeuygulmasının ne zaman yapılacağıvedikkatedilmesigerekenleribilir 39 7 FTP FTP Uzuvkopmasıdurumundauygulanacakilkyardımgirişimlerinibilir 39 7 FTP FTP Şokçeşitlerini/ belirtivebulgularınıaçıklar 39 7 FTP FTP Şoktauygulanacakilkyardımgirişimlerinibilir 39 7 FTP FTP Diğerkanamadurumlarında (göz,kulak,burun) ilkyardımbasamaklarınıbilir 39 7 FTP FTP28.7. Yaralanmalardailkyardım 39 7 FTP FTP Başveomurgayaralanmalarındakiilkyardımgirişimlerinibilir 39 7 FTP FTP Delicigöğüsyaralanmalarındakiilkyardımuygulamabasamaklarınıbili 39 7 FTP FTP Delicikarınyaralanmalarındailkyardımuygulamabasamaklarınıbilir 39 7 FTP FTP Kırık,çıkık,burkulmabelirti/bulgularıveilkyardımbasamaklarınıbilir 39 7 FTP FTP28.8. YanıklardaIlkyardım 39 7 FTP FTP Yanıkderecelerini (birinci, ikinci,üçüncüdereceyanık) bilir 39 7 FTP FTP Yanıklardauygulanacakilkyardımbasamaklarınıaçıklar 39 7 FTP FTP Kimyasalyanıklardailkyardımbasamaklarınıbilir 39 7 FTP FTP Elektrikveradyasyonyanıklarındakiilkyardımbasamaklarınıbilir 39 7 FTP FTP28.9. HastalıklardaIlkyardım 39 7 FTP FTP Bilinçbozukluklarında(senkop,koma,havale,inme) ilkyardımbasamaklarınıbilir 39 7 FTP FTP Epilepsinöbetindegörülenbelirti/bulgular, tetikleyenfaktörlerveilkyardımbasamaklarınıbilir 39 7 FTP FTP Hipoglisemi/hiperglisemibelirtibulgularınıbilir, ilkyardımbasamaklarınıaçıklar 39 7 FTP FTP Kalpspazmıvekalpkrizibelirtibulgularınıbilir 39 7 FTP FTP Kalpkrizidurumundauygulanacakilkyardımgirişimleriniaçıklar 39 7 FTP FTP Alerjikreaksiyonlar, anaflaktikreaksiyonlardauygulanacakilkyardımgirişimlerinibilir 39 7 FTP FTP28.. ToksikolojikAciller 39 7 FTP FTP Sindirimyoluylazehirlenmelerde (gıda, kimyasalmadde, ilaçvealkol) uygulanacakilkyardımgirişimleriniaçıklar 39 7 FTP FTP Solunumyoluylazehirlenmelerdeuygulanacakilkyardımgirişimlerinia çıklar 39 7 FTP FTP28..4 Deri yoluylazehirlenmelerdeuygulanacakilkyardımgirişimleriniaçıklar 39 7 FTP FTP28.. HayvanIsırıklarıveBöcekSokmaları 39 7 FTP FTP Akrepsokmalarındauygulanacakilkyardımbasamaklarınıbilir 8

159 tat 39 Kısames FTP FTP Yılansokmalarındauygulanacakilkyardımbasamaklarınıbilir 39 7 FTP FTP Keneısırmasıdurumundauygulanacakilkyardımbasamaklarınıbilir 39 7 FTP FTP Keneçıkarılırkendikkatedilmesigerekennoktalarıaçıklar Deniz canlılarınınsokması (denizkestanesi,denizanası) 39 7 FTP FTP28.. durumundauygulanacakilkyardımgirişimlerinibilir 39 7 FTP FTP28.2. ÇevreselSorunlar 39 7 FTP FTP28.2. Hipotermiderecelerini (hafif-orta-derin) belirtibulgularınıveuygulanacakilkyardımgirişimlerinibilir 39 7 FTP FTP Donukdokununçözülmebasamaklarınıaçıklar Sıcağabağlısorunlarda (sıcakbitkinliği,sıcakçarpması) 39 7 FTP FTP ilkyardımbasamaklarınıbilir 39 7 FTP FTP Boğulmalardailkyardımbasamaklarınıaçıklar 39 7 FTP FTP28.2. Yıldırımçarpmasındauygulanacakilkyardımgirişimlerinibilir 39 7 FTP FTP28.3. Hasta veyaralıtaşımateknikleri 39 7 FTP FTP Hasta/yaralıtaşınmasındagenelkurallarıbilir 7 FTP FTP Aciltaşımatekniklerini(sürükleme, rentekmanevrası)bilir 39 7 FTP FTP Sedyeüzerineyerleştirmetekniklerinibilir FTP FTP Kısamesafedesüratlitaşımatekniklerinibilir Hafta-Tarih DersKonuları İlgili Program Yeterliği -4Şubat 22 UyumHaftası 2 7-2Şubat 22 İlk ve Acil Yardımın Tanımı, Temel İlkeleri, Amacı PY3-PY9-PY Şubat22 Hastanın/Yaralının Değerlendirilmesi, Koma Pozisyonu PY3-PY9-PY Mart 22 Yetişkinlerde Ve Çocuklarda Solunum Yolu Tıkanması PY9-PY-PY2 9-3 Mart 22 Solunum ve Dolaşımın Durması Ve Kalp Akciğer Canlandırılması (CPR) (Yetişkin)/TYD PY9-PY-PY Mart 22 Solunum ve Dolaşımın Durması Ve Kalp Akciğer Canlandırılması (CPR) (Çocuk Ve Bebek)/TYD PY9-PY-PY Mart 22 Kanamalar, Şok ve Şok Tedavisi PY9-PY 28 Mart- Nisan 22 Ara Sınav 8 6- Nisan 22 YaralanmalardaIlkyardım PY9-PY-PY Nisan 22 YanıklardaIlkyardım PY9-PY 2-24 Nisan 22 HastalıklardaIlkyardım PY9-PY 27 Nisan-Mayıs22 ToksikolojikAciller PY9-PY 2 4-8Mayıs22 HayvanIsırıklarıVeBöcekSokmaları PY9-PY 3 -Mayıs22 ÇevreselSorunlar PY9-PY Mayıs 22 Hasta veyaralıtaşımateknikleri PY9-PY-PY2 3 Mayıs-7Haziran22 DönemSonuSınavı -2 Haziran 22 BütünlemeSınavı Değerlendirme Bu dersindeğerlendirmesi, kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçm elibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır. 9

160 ) Yanıklardauygulanacak ilk yardımgirişimlerindenhangisiyanlıştır? a) Yanmaişlemidurdurulmalı, yaralınınüzerinebattaniyeörterekyerdeyuvarlanmasınısağlamakfaydalıolabilir b) Soğutmaişlemiuygulanmalıdır c) Yanıktanetkilenenbölgedekitakılarçıkarılmalıdır d) Akan sualtındaenaz dakikaboyuncasuyatutulmalıdır e) Yanıksonrasıoluşansukeseleripatlatılmalıdır 2) BebeklerdeTemelYaşamDesteğibasamaklarıileilgilihangisiyanlıştır? Örneksorular a) Bebeğinayaktabanınavurularakbilinçdurumudeğerlendirilir b) Göğüskafesini 4 cm çöktürecekşekildebasıuygulanmalıdır c) Kalpmasajıikiparmaklauygulanmalıdır d) Her durumdabebeğe 3 kalpmasajı 2 sunisolunumuygulanmalıdır e) Sunisolunumverilirkenbebeğinağızveburunukapsayacakşekildeverilmelidir 3)Kimyasalmaddeilezehirlenmedurumundayapılmamasıgerekenaşağıdakilerde nhangisidir? a) Hasta kusturulmayaçalışılmalıdır b) Küçükmiktarlardakimyasalmaddealındıysa ( yudumgibi) birazsuya da sütiçerilmelidir c) 4 aranmalıdır. Doktorönerileridoğrultusundahareketedilmelidir d) Kişininyaşamsalbulgularıdeğerlendirilmelidir e) Kimyasalmaddekutularısağlıkpersonelinegösterilmeküzereyanınaalınmalıdır. CevapAnahtarı -e 2-d 3-a KaynakKitap YardımcıKaynaklarve Okuma Listesi Üniversiteler, HemşirelikFakülteleriveSHMYO lariçin İLKYARDIM YAZAR-EDİTÖR; Gürkan ÖZEL, Yrd. Doç. Dr. Betül AKBUĞA ÖZEL, Yrd. Doç. Dr. Cihangir ÖZCAN- Uz. Muammer SARUGAN GÜNEŞ TIP KİTABEVLERİ SAĞLIK HİZMETLERİ, MEGEP İLKYARDIM MODÜLLERİ, ANKARA,26 FTP-24 MESLEKİ UYGULAMA Öğretim Üyesi Öğr.Gör. Mehmet Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Ortaöğretim düzeyinde kazanılan yeterliliklere dayalı olarak Fizyoterapi alanındaki güncel bilgileri içeren ders kitapları, uygulama araç-gereçleri ve diğer kaynaklarla 6

161 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu desteklenen temel düzeydeki kuramsal ve uygulamalı bilgilere sahip olabilmek. Konu ve ilgili kazanım 39 7 FTP FTP24.. TENS uygulamaları 39 7 FTP FTP24.. TENS parametrelerini bilir 39 7 FTP FTP24..2 TENS uygulayabilir FTP FTP24.2. TENS uygulamaları 39 7 FTP FTP TENS parametrelerini bilir 39 7 FTP FTP TENS uygulayabilir FTP FTP24.3. Galvanik akım uygulamaları 39 7 FTP FTP24.3. Galvanik parametrelerini bilir 39 7 FTP FTP Galvanik uygulayabilir FTP FTP24.4. Faradik akım uygulamaları 39 7 FTP FTP Faradik parametrelerini bilir 39 7 FTP FTP Faradik uygulayabilir FTP FTP24.. Diadinamik akım uygulamaları 39 7 FTP FTP Diadinamik parametrelerini bilir 39 7 FTP FTP24.. Diadinamik uygulayabilir FTP FTP24.6. NMES uygulamaları 39 7 FTP FTP24.6. NMESparametrelerini bilir 39 7 FTP FTP NMES uygulayabilir FTP FTP24.7. Enterfarrensiyel akım uygulamaları 39 7 FTP FTP Enterfaresiyel parametrelerini bilir 39 7 FTP FTP Eterfarensiyel uygulayabilir FTP FTP24.8. Rus akım uygulamaları 39 7 FTP FTP24.8. Rus akım parametrelerini bilir 39 7 FTP FTP Rus akım uygulayabilir FTP FTP24.9. Yüksek voltajlı kesikli palvanik akım uygulamaları 39 7 FTP FTP Yüksek voltajlı kesikli galvanik akımın parametrelerini bilir 39 7 FTP FTP Yüksek voltajlı kesikli galvanik akımı uygulayabilir FTP FTP24.. Parametreler 39 7 FTP FTP24..9 Tüm konu parametrlerini bilir FTP FTP24.. Fizyoterapi uygulamalarında dikkat edilecek hususlar 39 7 FTP FTP24..2 Endikasyon ve kontraendikasyanları bilir FTP FTP24.2. Uygulamalar 39 7 FTP FTP Uygulmalı olarak öğrenir FTP FTP24.3. Tekrar 39 7 FTP FTP Tüm konu tekrar eder. Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 Uyum Haftası PY Şubat 22 TENS uygulamaları PY3-PY Şubat 22 TENS uygulamaları PY3-PY Mart 22 Galvanik akım uygulamaları PY3-PY4 9-3 Mart 22 Faradik akım uygulamaları PY3-PY Mart 22 Diadinamik akım uygulamaları PY3-PY Mart 22 NMES uygulamaları PY3-PY4 28 Mart- Nisan 22 Ara sınav 8 6- Nisan 22 Enterfarrensiyel akım uygulamaları PY3-PY Nisan 22 Rus akım uygulamaları PY3-PY4 6

162 Dersin Kazanıml arı Okul Program Ders Konu Kazanım Kodu 2-24 Nisan 22 Yüksek voltajlı kesikli palvanik akım uygulamaları PY3-PY4 27 Nisan- Mayıs 22 Parametreler PY3-PY Mayıs 22 Fizyoterapi uygulamalarında dikkat edilecek hususlar PY3-PY4 3 - Mayıs 22 Uygulamalar PY3-PY Mayıs 22 Tekrar PY3-PY4 3 Mayıs -7 Haziran 22 Yarıyıl sonu sınavları -2 Haziran 22 Bütünleme sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli, klasik, boşluk doldurma ve D/Y bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. - Alçak frekaslı akımların fizyolojik etkilerini yazınız? Örnek Sorular 2- FTR de kullanılan US aletlerinde maksimum güç Watt ile sınırlandırılmıştır. 3- Biofeedback nedir? - Duyu sinirleri üzerine Motor sinirler üzerine Denerve kaslar üzerine Cevap Anahtarı -Kimyasal etkisi -Isı etkisi 2-3- Biyolojik ve otonom sinir sistemi tarafından otomatik olarak ayarlanan sistemlerin işitsel ve görsel sinyallerle bilinçli olarak kontrolü Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi TherapeuticExercise, J.V. Basmajian, 99 TherapeuticExercisesfor Body AlignmentandFunction, L. Daniels, M. Williams, C. Worthingham, 972 TherapeuticExerciseFoundationsandTechniques, C. Kisner, L.A. Colby, 99 FTP 22- SAĞLIK SOSYOLOJİSİ Öğretim Üyesi Elif BAYAZIT Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Öğrencilere temel bazı sosyolojik bilgileri ve görüşleri kazandırarak, sağlık ve hastalık olgularına sadece bedensel açıdan değil, sosyal açıdan da bakabilme becerisi kazandırmak Konu ve ilgili kazanım 62

163 39 7 FTP FTP22.. Sağlık sosyolojisine giriş, temel kavramlar, bilimsel bilgi, verinin toplanma süreci, bilim, sosyal bilim ve sosyoloji kavramlarının tanıtılması FTP FTP22.. Sağlık sosyolojisinin konusunu, amacını bilir FTP FTP22..2 Sağlık sosyolojisinin temel kavramlarını bilir FTP FTP22..3 Toplumu ve toplumsal yapıyı tanır FTP FTP22..4 Sağlık sosyolojisinin, tarihsel gelişimini, eşitsizlikleri, farklı sağlık sorunlarını, hastalık teşhisinin psişik ve sosyal boyutlarını bilir FTP FTP22.2. Kültür, birey, sosyal etkileşim, grup ve organizasyon, sosyal kontrol biçimleri, sosyal tabakalaşma, ekonomi, iş hayatı, aile ve evlilik 39 7 FTP FTP22.2. Birey, aile ve toplumu tanır FTP FTP Kültürü tanımlar FTP FTP Toplumdaki spsyal grupları ve sosyal etkileşimleri tanımlar FTP FTP22.3. Türkiye nin toplumsal yapısı ve Türkiye de sağlık, eğitim sağlık gibi temel sosyal kurumlar 39 7 FTP FTP Türkiye'nin toplumsal yapısını tanımlar FTP FTP Türkiye de başlıca sağlık kurumlarını ve bu kurumların tarihçesini tanımlar FTP FTP22.3. Türkiye' deki eğitim sağlık gibi temel sosyal kurumların yapı ve işlevlerini tanımlar FTP FTP22.3. Türkiye'deki sağlık uygulamalarını bilir FTP FTP22.4. Sağlık ve hastalık kavramları, sağlık ve hastalığın toplumsal kuruluşu, medikal ve sosyal model, toplumsal ilişkiler 39 7 FTP FTP Sağlık, hastalık kavramlarını sosyolojik olarak tanımlar FTP FTP Türkiye'de sağlık ve hastalığın toplumsal kuruluşunu bilir FTP FTP Sağlık uygulamalarındaki medikal ve sosyal modeli tanımlar FTP FTP22.4. Sağlık uygulamalarındaki medikal ve sosyal modeli sosyolojik olarak karşılaştırır FTP FTP22.. Sağlığa ulaşmada eşitsizlikler 39 7 FTP FTP22..6 Sağlığa ulaşmadaki eşitsizliğin fakındadır FTP FTP22..7 Sağlığa ulaşmada eşitsizliği kaldırmak için bireylere rehberlik eder FTP FTP22..8 Sağlığa ulaşmada eşitsizliği kaldırmak için bireyleri uygun kurumlara yönlendirir FTP FTP22.6. Hasta rolü, sağlık çalışanı- hasta etkileşimi, sağlık çalışanı olarak kendini tanıma 39 7 FTP FTP Hasta rolünü tanımlar FTP FTP Sağlık çalışanı- hasta etkileşiminin öneminin farkındadır FTP FTP Hasta ile iletişimde kendini tanımanın önemini bilir FTP FTP22.7. Hasta ilişki ağı ve hasta- hastane ilişkisi 39 7 FTP FTP Hastanede hasta ve çalışanların ilişkisini inceler FTP FTP Hastalarla etkin iletişim kurar FTP FTP22.8. Teşhisin anlamı ve özellikleri, alternatif tıbbi yönelimler 39 7 FTP FTP Teşhisi tanımlar FTP FTP Doğru teşhisin önemini tanımlar FTP FTP Tedavide kullanılan alternatif tıbbi yönelimleri tanır FTP FTP Tedavide kullanılan alternatif tıbbi yöntemleri bilir FTP FTP22.9. Biyopsikososyal tıp modeli, plasebo ve nocebo etkisi 39 7 FTP FTP Biyopsikososyal tıp modelini tanır FTP FTP Plesebo terimini tanır FTP FTP Plesebonun kullanıldığı durumları bilir FTP FTP Nocebo terimini bilir FTP FTP Nocebonun kullanıldığı durumları bilir FTP FTP22.. Stres, baş etme, akıl sağlığı, madde bağımlılığının toplumsal kökenleri 39 7 FTP FTP Stresi tanımlar. 63

164 39 7 FTP FTP Stresle baş etme yöntemlerini bilir FTP FTP22..3 Türkiye'de madde bağımlılığı oranını bilir FTP FTP Madde bağımlısı olan bireyleri uygun kurumlara yönlendirir FTP FTP22.. İntiharlar, intihar türleri ve Türkiye de intiharlar 39 7 FTP FTP İntiharı tanımlar FTP FTP İntihar yöntemlerini bilir FTP22 39 İntihara yatkın kişileri tanır ve sağlık çalışanı olarak bireyleri etkin 39.7.FTP şekilde yönlendirir FTP FTP22..4 Yaşlılarda intihar oranını bilir FTP FTP22..4 Yaşlılarda intihara yönlendiren durumları bilir FTP FTP Türkiye'deki intihar oranını tanımlar FTP FTP22.2. Doğal afetler ve sağlığa etkisi 39 7 FTP FTP Doğal afetleri tanımlar FTP FTP Doğal afet çeşitlerini bilir FTP FTP Doğal afetlerden korunma yollarını bilir FTP FTP Doğal afetlerin toplumsal etkilerini bilir FTP FTP Doğal afet esnasında yapılması gerekenleri bilir FTP FTP22.3. Cinsel tutumlar, toplumsal dışlanma, çocuklar, engelliler yaşlılar, kronik hastalıklar ve toplumsal tutumlar 39 7 FTP FTP Toplumlara göre cinsel tutumları bilir FTP FTP Çocuklar, engelliler ve yaşlılara toplumun bakış açısını bilir FTP FTP22.3. En sık görülen kronik hastalıkları tanımlar FTP FTP22.3. Kronik hastalıklarda toplumsal tutumları bilir. Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 Uyum Haftası PY9-PY-PY-PY Şubat 22 Sağlık sosyolojisine giriş, temel kavramlar, bilimsel bilgi, verinin toplanma süreci, bilim, sosyal bilim ve sosyoloji kavramlarının PY9-PY-PY-PY2 tanıtılması Şubat 22 Kültür, birey, sosyal etkileşim, grup ve organizasyon, sosyal kontrol biçimleri, sosyal tabakalaşma, ekonomi, iş hayatı, aile ve PY9-PY-PY-PY2 evlilik Mart 22 Türkiye nin toplumsal yapısı ve Türkiye de sağlık, eğitim sağlık gibi temel sosyal kurumlar PY9-PY-PY-PY2 9-3 Mart 22 Sağlık ve hastalık kavramları, sağlık ve hastalığın toplumsal kuruluşu, medikal ve sosyal model, toplumsal ilişkiler PY9-PY-PY-PY Mart 22 Sağlığa ulaşmada eşitsizlikler PY9-PY-PY-PY Mart 22 Hasta rolü, sağlık çalışanı- hasta etkileşimi, sağlık çalışanı olarak kendini tanıma PY9-PY-PY-PY2 28 Mart- Nisan 22 Ara Sınav 8 6- Nisan 22 Hasta ilişki ağı ve hasta- hastane ilişkisi PY9-PY-PY-PY Nisan 22 Teşhisin anlamı ve özellikleri, alternatif tıbbi yönelimler PY9-PY-PY-PY Nisan 22 Biyopsikososyal tıp modeli, plasebo ve nocebo etkisi PY9-PY-PY-PY2 27 Nisan- Mayıs 22 Stres, baş etme, akıl sağlığı, madde bağımlılığının toplumsal kökenleri PY9-PY-PY-PY Mayıs 22 İntiharlar, intihar türleri ve Türkiye de intiharlar PY9-PY-PY-PY2 3 - Mayıs 22 Doğal afetler ve sağlığa etkisi PY9-PY-PY-PY Mayıs 22 Cinsel tutumlar, toplumsal dışlanma, çocuklar, engelliler yaşlılar, kronik hastalıklar ve toplumsal tutumlar PY9-PY-PY-PY2 3 Mayıs-7 Haziran 22 Dönem Sonu Sınavı -2 Haziran 22 Bütünleme Sınavı Değerlendirme Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas alınarak hazırlanacak olan çoktan seçmeli ve klasik soruların olduğu bir vize ve bir final aracılığıyla 64

165 yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır.. Sağlık ve hastalığa ilişkin aşağıdaki ifadelerden hangisi yanlıştır? a) Sağlık ve hastalık kavramları her toplumun sosyal ve kültürel özelliklerine göre tanımlanmaktadır. b) Durkheim medikal açıdan hastalık durumuyla, hastanın bakış açısından rahatsızlık durumunun farklılığına işaret eder. c) Parsons'a göre sosyal sistemin dengesi bireylerin toplumda kendine düşen rolü oynamasına bağlıdır. d) Toplumsal yaşam içinde her birey belirli rol ve sorumluluklara sahiptir. Bireyin bu rol ve sorumluluklarını tam olarak yerine getirmesi sağlıklı olduğunu göstermektedir. e) Sağlık ve hastalığa ilişkin çalışmalar önceleri sağlık bilimciler tarafından biyomedikal model çerçevesinde gerçekleştirilmiştir. 2. Aşağıdakilerden hangisi hastalık (disease) durumunu anlatmaktadır? a) Sağlıksızlığın veya patolojik sürecin sonuçlarının öznel deneyim içinde bireyce algılanması b) Bireyin sahip olduğu rahatsızlık durumunu, bu duruma kendisinin ve çevresindekilerin tepkisinin yansıması c) Sübjektif anlamdaki, bireyin sahip olduğu rahatsızlık durumu d) İnsan organizmasının nasıl çalıştığına dair anatomi bilgisiyle alakalı, sadece gözlenebilir işaretlerle anlaşılabilen gizli bir süreç Örnek Sorular e) Bireyin öznel deneyim içinde kendini rahatsız hissetmesi, ağrı ve acı duyması 3. Sosyolojik açıdan sapma ya da sapkın davranış kavramıyla ilgili olarak aşağıdaki ifadelerden hangisi yanlıştır? a) Sosyal normlara uymayan davranış sapma olarak düşünülmektedir. b) Sapma hiçbir yargı belirtmemesi ve ima etmemesiyle nötr bir terimdir. c) Sosyolojik perspektiften sapkın terimi hem değer yargısı taşır hem de ahlaki bir anlama sahiptir. d) Hastalık sapan bir statü olarak algılanır ve birey özel problemlerini halletmek için sapan bir rol oynar. e) Grup ve toplumun normatif beklentilerine uymayan genel bir davranış sapkın olarak düşünülmektedir. 4. Hasta rolüyle ilgili aşağıdaki ifadelerden hangisi yanlıştır? a) Kasıtlı olmayan bir sapma olarak hastalık durumunda birey hasta rolü ve statüsüne geçer. b) Hasta rolünü kabullenerek doktora giden birey, sosyal tanınma sağlar. c) Parsons öncelikle birbirine bağlı sosyal roller sistemiyle ve toplumdaki dinamizmi ve değişmeyi açıklamakla ilgilenmiştir. d) Hasta rolü vasıtasıyla sorumluluklardan kaçma toplumda diğer bireylere de bulaşabilir. e) Parsons, genel olarak, toplumun, hem hekimlere hem de hastalara belirli bir rolü önsel olarak biçtiğini ve bireylerin hastanelerde sadece bu tür rolleri oynadıklarını belirtmiştir. 6

166 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu Cevap Anahtarı.B 2.D 3.C 4.C Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi - Bozkurt, Veysel. (2) Değişen dünyada sosyoloji FTP23 MESLEKİ YABANCI DİL II Öğretim Görevlisi Emrah ÇEVİK Oda Numarası E-posta Ders Zamanı Pazartesi Derslik Dersin Amacı Öğrencilere temel gramer yapılarını, ilgili konu anlatımları ve egzersizlerin yardımı ile öğretmek ve belirli bir düzeyde İngilizce okuma- anlama- yazma becerilerini geliştirmek. Konu ve ilgili kazanım 39 7 FTP FTP23.. Sahiplik bildiren kelimeler (havegot, has got) 39 7 FTP FTP23.. havegot ve has got kelimelerinin cümledeki anlamını ve kullanım yerlerini öğrenir FTP FTP23..2 havegot ve has got kullanarak olumlu, olumsuz ve soru cümleleri oluşturnayı öğrenir FTP FTP23.2. Simple Past Tense (Geçmiş Zaman) 39 7 FTP FTP Geçmiş zamanda olumlu,olumsuz,soru cümleleri kurmayı öğrenir FTP FTP Geçmiş zamanda kullandığımız zaman zarflarını öğrenir FTP FTP23.2. Geçmiş zamana ait cümlelerin kullanım yerlerini öğrenir FTP FTP23.3. PastContinuous Tense 39 7 FTP FTP PastContinuousTense deolumlu,olumsuz,soru cümleleri kurmayı öğrenir FTP FTP PastContinuousTense de kullandığımız zaman zarflarını öğrenir FTP FTP PastContinuousTense eait cümlelerin kullanım yerlerini öğrenir FTP FTP23.4. RegularVerbs (Düzenli Fiiller) ve IrregularVerbs (Düzensiz Fiiller) 39 7 FTP FTP Geçmiş zamanda sonuna -ed eki alarak kullanılan düzenli fiilleri öğrenir FTP FTP23.4. Geçmiş zamanda -ed eki almayan ve tamamen başka bir 66

167 kelime ile temsil edilen düzensiz fiilleri öğrenir FTP FTP23.4. Düzenli ve düzensiz fiillerin cümlelerde kullanımını öğrenir FTP FTP23.. PresentTensesfor he Future 39 7 FTP FTP23..2 Gelecek zaman hakkında bilgi sahibi olur 39 7 FTP FTP23..3 Gelecek zamanda oluşacak olaylar için şimdiki zaman ve geniş zaman kullanımını öğrenir. (i am doing, i do) 39 7 FTP FTP23.6. Future Tense (Gelecek Zaman) 39 7 FTP FTP will yardımcı fiili ile gelecek zamanda olumlu, olumsuz ve soru cümleleri kurmayı öğrenir FTP FTP23.6. begoingto yardımcı fiili ile gelecek zamanda olumlu, olumsuz ve soru cümleleri kurmayı öğrenir FTP FTP23.7. Sayılabilen (Countable) ve Sayılamayan (Uncountable) İsimler 39 7 FTP FTP Sayılabilen isimleri liste halinde öğrenir. Tekil veya çoğul 39 7 FTP FTP olarak kullanılıp kullanılmadıkları hakkında bilgi sahibi olur. Sayılamayan isimleri liste halinde öğrenir. Tekil veya çoğul olarak kullanılıp kullanılmadıkları hakkında bilgi sahibi olur FTP FTP23.8. Some ve Any kullanımı 39 7 FTP FTP Biraz anladaki some kelimesinin kullanımını öğrenir FTP FTP Hiç anlamına gelen any kelimesinin kullanımını öğrenir FTP FTP23.9. Belirsiz Zamirler (IndefinitePronouns) 39 7 FTP FTP FTP FTP Belirsiz zamirlerin cümledeki anlamını ve kullanım yerlerini öğrenir. (somebody, anybody, nobody) Belirsiz zamirler ile ilgili soru, olumlu ve olumsuz cümleler kurmayı öğrenir FTP FTP23.. Çokluk ve azlık belirten kelimeler 39 7 FTP FTP A lot, much, many kelimelerinin kullanımını öğrenir FTP FTP A little, a few kelimelerinin kullanımını öğrenir FTP FTP23.. both, either, neither kullanımı 39 7 FTP FTP FTP FTP23.2. Present Perfect Tense 39 7 FTP FTP FTP FTP herikisi, ikisinden biri, hiçibiri anlamlarına gelen both, either be neither kelimelerinin olumlu, olumsuz ve soru cümlelelerinde kullanımlarını öğrenir. Present Perfect Tense deolumlu,olumsuz,soru cümleleri kurmayı öğrenir. Hangi zaman dilimindeki olayları anlatmak için kullanıldığı hakkında bilgi sahibi olur. Present Perfect Tense de kullandığımız zaman ifadelerini öğrenir. (since, for, just,..) 39 7 FTP FTP23.3. Present Perfect Continuous Tense 39 7 FTP FTP Present Perfect ContinuousTense deolumlu,olumsuz,soru cümleleri kurmayı öğrenir. Hangi zaman dilimindeki olayları anlatmak için kullanıldığı hakkında bilgi sahibi olur FTP FTP23.4. Past Perfect Tense ve Past Perfect Continuous Tense Past Perfect Tense ve Past Perfect Continuous Tense ile 39 7 FTP FTP olumlu,olumsuz,soru cümleleri kurmayı öğrenir. Hangi zaman dilimindeki olayları anlatmak için kullanıldıkları Hafta-Tarih hakkında bilgi sahibi olur. Ders Konuları -4 Şubat 22 Uyum Haftası Şubat 22 Simple Past Tense (Geçmiş Zaman), Sahiplik bildiren kelimeler (havegot, has got) İlgili Program Yeterliği PY-PY Şubat 22 PastContinuous Tense PY-PY Mart 22 RegularVerbs (Düzenli Fiiller) ve IrregularVerbs (Düzensiz PY-PY6 Fiiller) 9-3 Mart 22 PresentTensesfor he Future PY-PY Mart 22 Future Tense (Gelecek Zaman) PY-PY Mart 22 Sayılabilen (Countable) ve Sayılamayan (Uncountable) İsimler PY-PY6 67

168 28 Mart- Nisan 22 Ara Sınav 8 6- Nisan 22 Some ve Any kullanımı PY-PY Nisan 22 Belirsiz Zamirler (IndefinitePronouns) PY-PY Nisan 22 Çokluk ve azlık belirten kelimeler PY-PY6 27 Nisan- Mayıs 22 both, either, neither kullanımı PY-PY Mayıs 22 Present Perfect Tense PY-PY6 3 - Mayıs 22 Present Perfect Continuous Tense PY-PY Mayıs 22 Past Perfect Tense ve Past Perfect Continuous Tense PY-PY6 3 Mayıs-7 Haziran 22 Yarıyıl Sonu Sınavı -2 Haziran 22 Bütünleme Sınavı Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas alınarak hazırlanacak olan çoktan seçmeli bir vize ve bir final aracılığıyla Değerlendirme yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır.. This is the book in thestore. a) worse b) mostbad c) baddest d) worst 2. A mouse is than a lion. a) weaker b) weakest c) moreweak d) moreweaker 3. Somegovernmentsare thanothers. a) mostbad b) moreworse c) morebad d) worse 4. Sugar is than salt. a) moresweet b) sweeter c) moresweeter d) sweetest.that wasthe exam I had allsemester. a) moredifficult b) difficultest c) mostdifficult d) mostdifficultest 6. My father (have) a lot of workto do everyweekend. a)have b)had c)has d)has had Örnek Sorular 7. Theboys.. (not / talk) now. All of them (watch) a film. a)talks/watches b)talked/arewatching c)is not talking/arewatching d)are not talking/arewatching 8. you.. (like) watching TV? a)does/like b)do/like c)did/likes d)do/likes 9. He.. (usually / go) at 8: o clock, but thismorning he.. (leave) homelate. a)usuallygoes/left b)usuallywent/leave c)usuallygo/left d)usuallygone/leave. I. (visit) mygrandparentseverysaturday. My sister. (often / visit) them. a)visit/oftenvisit b)visit/oftenvisits c)visits/oftenvisit d)visit/visit Cevap Anahtarı -d 2-a 3-d 4-b -c 6-c 7-d 8-b 9-a -b 68

169 D e Okul Program Ders Konu Kazanım Kodu Kaynak Kitap Yardımcı Kaynaklar ve Okuma Listesi Step by Step English Active English Grammer Step by Step English Active English Grammer FTP 232- ÇOCUK HASTALIKLARI VE FİZYOTERAPİ ÖğretimÜyesi Oda Numarası E-posta DersZamanı Derslik DersinAmacı Bu dersinamacı, çocukta normal büyümevegelişmeyianlatmak, pediatric hastalıklarkonusundabilgivermekve her hastalığınrehabilitasyonunudetaylarıileanlatmaktır. Konuveilgilikazanım 39 7 FTP FTP232.. Büyümevegelişme 39 7 FTP FTP232.. Normal motor gelişimbasamaklarınıbilir FTP FTP Patolojikgelişimkliniközelliklerinibilir FTP FTP Büyümevegelişme 39 7 FTP FTP Çocuk hasta rehabilitasyonilkelerinitanımlar.çocuk hasta rehbilitasyonununendiksiyonvekontraendiksiyonlarınıveilgilitermi nolojiyiaçıklar FTP FTP Mental motor gelişim 39 7 FTP FTP Mental motor gelişimbasamaklarınıbilir FTP FTP Mental gelişimtestleriniöğrenir FTP FTP Serebralpalsidedeğerlendirme 39 7 FTP FTP Serebralpalsitanımınıyapar FTP FTP Serabralpalsideğerlendirmebasamaklarınıöğrenir FTP FTP Serabralpalsideğerlendirmesiniyapabilir FTP FTP232.. Serebralpalsirehabilitasyonu 39 7 FTP FTP Serabralpalsirehabilitasyonkriterlerinibilir FTP FTP232.. Serabralpalsirehabilitasyonunuyapabilir FTP FTP PediatrikTravmatikBeyinHasarıRehabilitasyonu 39 7 FTP FTP Çocuk hasta beyintravmasıdeğerlendirmesinibilir FTP FTP Çocuk hasta travmatikbeyinhasarırehabilitasyonunuyapabilir. 69

170 39 7 FTP FTP MiyopatiliÇocuklardaRehabilitasyon 39 7 FTP FTP Miyopatiliçocuklardarehabilitasyonkriterlerinibilirveuygulamasın ıyapabilir FTP FTP ObstetrikPalsiRehabilitasyonu 39 7 FTP FTP Obstetric palsirehabilitasyonkriterlerinibilirvedikkatedilmesigerekennoktala rilebirlikterehabilitasyondeğerlendirmeveuygulamasınıyapabilir FTP FTP SkolyozRehabilitasyonu 39 7 FTP FTP Çocukhastalardaskolyozdeğerlendirmesiniyaparveskolyozçeşidin ekararverebilir FTP FTP Çocukhastalardaskolyoztedavisiniyapabilir FTP FTP232.. ÇocuklardaRomatolojikRehabilitasyon 39 7 FTP FTP Çocukhastalardaromatolojikrehabilitasyondeğerlendirmesiniyapab ilir FTP FTP Çocukhastalardaromatolojik hasta rehabilitasyonunuyapabilir FTP FTP232.. ÇocuklardaOrtopedikRehabilitasyon 39 7 FTP FTP Çocuklardaortopedikrehabilitasyondeğerlendirmesiniyapabilir FTP FTP Çocuklardaortopedikrehabilitasyonuygulamasınıyapabilir FTP FTP ÇocuklardaTeröpatikEgzersizler 39 7 FTP FTP Çocuklardateröpatikegzersizleribilirveuygulamasınıyapabilir FTP FTP ÇocuklardaOrtezlerVeYardımcıCihazlar 39 7 FTP FTP Çocuklardaengeldurumunagöregerekliolanortezveyardımcıcihazla 39 7 FTP FTP rakararverebilir. Gerekliolanortezveyardımcıcihazlarırehabilitasyonuygulamalarık apsamındakullanabilir FTP FTP Çocuk hasta rehabilitasyonuygulamalarınıyapabilir. Hafta-Tarih DersKonuları İlgili Program Yeterliği -4Şubat 22 UyumHaftası 2 7-2Şubat 22 BüyümeveGelişme PY PY Şubat22 Mental Motor Gelişim PY PY2 PY Mart 22 SerebralPalsideDeğerlendirme PY PY4 9-3 Mart 22 SerebralPalsiRehabilitasyonu PY Mart 22 PediatrikTravmatikBeyinHasarıRehabilitasyonu PY7 PY Mart 22 MiyopatiliÇocuklardaRehabilitasyon PY 28 Mart- Nisan 22 Ara sınav 8 6- Nisan 22 Spina Bifida Rehabilitasyon PY Nisan 22 ObstetrikPalsiRehabilitasyonu PY 2-24 Nisan 22 SkolyozRehabilitasyonu PY PY2 27 Nisan-Mayıs22 ÇocuklardaRomatolojikRehabilitasyon PY PY2 PY Mayıs22 ÇocuklardaOrtopedikRehabilitasyon PY PY2 PY3 3 -Mayıs22 ÇocuklardaTeröpatikEgzersizler PY PY Mayıs 22 ÇocuklardaOrtezlerVeYardımcıCihazlar PY PY4 3 Mayıs-7Haziran22 DönemSonuSınavı -2 Haziran 22 BütünlemeSınavı Bu dersindeğerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacakolançoktanseçmelibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır. 7

171 Örneksorular.)Serebralpalsiliçocuklarınbirkısmına belli dönemlerdeortopedikcerrahitedaviyapılmasıgerekmektedir. Ancakbugirişimbazıhastalardafonksiyonudaha da bozmaktadır. Aşağıdakilerdenhangisicerrahitedavininolasıbaşarısızlıknedenlerindenbirideğildir? A) Aileninaşırıbeklentisi B) Deformiteninyeterincedüzeltilememesi C) Çocuğunbüyümesininhesabakatılmaması D) Preoperatifuygunrehabilitasyonprogramıyapılmaması 2.)Çocukveadölesanlardagörülenaşağıdakiskolyoznedenlerindenhangisiyapısalolmayan (non-structural) skolyoznedenidir? A) Postural B) İdiopatik C) Konjenital D) Travmatik E) Neurofibromatozisebağlı 3.)Çocuklardaensıkgörülenbening spinal tü- möraşağıdakilerdenhangisidir? A) Miyelom B) Lenfoma C) Osteokondrom D) Ewing sarkomu E) Anevrizmalkemikkisti CevapAnahtarı.D 2.A 3.C KaynakKitap PediatrikFizyoterapiRehabilitasyon TülayTarsuslu ŞİMŞEK YardımcıKaynaklarve Okuma Listesi _ FTP 228- TIBBİ DEONTOLOJİ VE ETİK ÖğretimÜyesi Elif BAYAZIT Oda Numarası E-posta DersZamanı Derslik DersinAmacı Deontolojiveetikleilgilitemelkavramveyaklaşımların, etikilkelerin, hasta hakları, yaşlılıklailgilietikkavramlarınöğretilmesidir. 7

172 D er Okul Program Ders Konu Kazanım Kodu Konuveilgilikazanım 39 7 FTP FTP228.. Deontolojinedir? Tanımvegiriş FTP FTP228.. Deontolojinintanımıbilir FTP FTP Deontolojiilesağlıkhizmetleriarasındakiilişkiyikavrayabilir FTP FTP Etikkavramveilkeler 39 7 FTP FTP Etiğitanımlayabilir FTP FTP Etikilkelerin ne olduğunubilir FTP FTP Deontolojiveetikarasındakiayırımıyapabilir 39 7 FTP FTP Mesleknedir? Mesleğimeslekyapanilkeler? 39 7 FTP FTP Mesleğintanımınıyapabilir FTP FTP228.. Deontolojinintanımıbilir FTP FTP Deontolojiilesağlıkhizmetleriarasındakiilişkiyikavrayabilir FTP FTP Etikkavramveilkeler 39 7 FTP FTP Etiğitanımlayabilir FTP FTP Etikilkelerin ne olduğunubilir FTP FTP Deontolojiveetikarasındakiayırımıyapabilir 39 7 FTP FTP Mesleknedir? Mesleğimeslekyapanilkeler? 39 7 FTP FTP Mesleğintanımınıyapabilir FTP FTP228.. Deontolojinintanımıbilir FTP FTP Deontolojiilesağlıkhizmetleriarasındakiilişkiyikavrayabilir FTP FTP Etikkavramveilkeler 39 7 FTP FTP Etiğitanımlayabilir FTP FTP Etikilkelerin ne olduğunubilir FTP FTP228.. Deontolojinintanımıbilir FTP FTP Deontolojiilesağlıkhizmetleriarasındakiilişkiyikavrayabilir FTP FTP Etikkavramveilkeler 39 7 FTP FTP Etiğitanımlayabilir FTP FTP Etikilkelerin ne olduğunubilir FTP FTP Deontolojiveetikarasındakiayırımıyapabilir 39 7 FTP FTP Mesleknedir? Mesleğimeslekyapanilkeler? 39 7 FTP FTP Mesleğintanımınıyapabilir FTP FTP228.. Deontolojinintanımıbilir FTP FTP Deontolojiilesağlıkhizmetleriarasındakiilişkiyikavrayabilir FTP FTP Etikkavramveilkeler 39 7 FTP FTP Etiğitanımlayabilir FTP FTP Etikilkelerin ne olduğunubilir FTP FTP Deontolojiveetikarasındakiayırımıyapabilir 39 7 FTP FTP Mesleknedir? Mesleğimeslekyapanilkeler? 39 7 FTP FTP Mesleğintanımınıyapabilir FTP FTP228.. Deontolojinintanımıbilir FTP FTP Deontolojiilesağlıkhizmetleriarasındakiilişkiyikavrayabilir FTP FTP Etikkavramveilkeler 39 7 FTP FTP Etiğitanımlayabilir FTP FTP Etikilkelerin ne olduğunubilir FTP FTP SağlıkHizmetlerindeTıbbiKötüUygulamalar, Ayrımyapmamak, ÇıkarİlişkisiKurmamak 39 7 FTP FTP Tıbbikötüuygulamanın ne anlamageldiğinibilir FTP FTP Sağlıkhizmetlerindeeşitdavranmanınveçıkarilişkisikurmamanın ne anlamageldiğinibilir FTP FTP Sağlıkhizmetinin ne şekildeveetikkurallaragöreuygulanmasınıbilir FTP FTP Ötenaziveetik,bilimselbilgikullanmak,OrganTransplantasyonların daetik, SağlıkÇalışanlarınınToplumsalYükümlülükleri 72

173 39 FTP FTP Ötenazinin ne anlamageldiğinibilir. 39 FTP FTP Ötenazivedeontolojikavramlarınıilişkilendirebilir. 39 FTP FTP Organ transplantasyonundakarşılaşılanetiksorunlarvesağlıkçalışanlarının yükümlülükleriniaçıklayabilir. Hafta-Tarih DersKonuları İlgili Program Yeterliği -4Şubat 22 UyumHaftası 2 7-2Şubat 22 Deontolojinedir? Tanımvegiriş. PY Şubat22 Etikkavramveilkeler PY Mart 22 Mesleknedir? Mesleğimeslekyapanilkeler? PY8 9-3 Mart 22 Sağlıkhizmetlerindeekipçalışması, PY8-PY2 sağlıkpersonelinintoplumdakiyeri Mart 22 İlkçağ, ortaçağ, yeniçağda hasta bakımı PY8-PY Mart 22 Ülkemizdesağlıkmesleklerivegelişimi PY8 28 Mart- Nisan 22 Ara Sınav 8 6- Nisan 22 İnsanhaklarıevrenselbildirgesi PY Nisan 22 Sağlıkhakkı, hasta hakları PY Nisan 22 Geriatriveetik PY8 27 Nisan-Mayıs22 YaşlıBakımileİlgiliYasaveYönetmelikler, PY8 MeslekiGizliliğiKorumakveÖzelYaşamaSaygıGöstermek 2 4-8Mayıs22 Sağlıkhizmetlerindeetiksorunlar, kaynaklarındağıtımındaadalet PY8 3 -Mayıs22 SağlıkHizmetlerindeTıbbiKötüUygulamalar, Ayrımyapmamak, PY8-PY2 ÇıkarİlişkisiKurmamak Mayıs 22 Ötenaziveetik, bilimselbilgikullanmak, Organ PY8-PY2 TransplantasyonlarındaEtik, SağlıkÇalışanlarınınToplumsalYükümlülükleri 3 Mayıs-7Haziran22 DönemSonuSınavı -2 Haziran 22 BütünlemeSınavı Bu dersindeğerlendirmesi, Değerlendirme kaynakkitaplarvedersteyürütülentartışmalaresasalınarakhazırlanacakolançoktanseçmelibirvizevebir final aracılığıyla yapılacaktır. Vizeninortalamayakatkısı % 4 finalinkiise % 6 tır. Geçmenotu üzerinden 6 tır.. Eneskitıpetiğiilkesiaşağıdakilerdenhangisidir? A) Yararlılıkilkesi B) Özerkliğesaygıilkesi C) Aydınlatılmışonamilkesi D) Dürüstlükilkesi E) Adaletilkesi ÖrnekSorular 2. Aşağıdakiilkelerdenhangisi hasta veailesinegerçeğisöyleme, dürüstolmazorunluluğugetirir? A) Sadakat/sözündedurmak B) Dürüstlükdoğrulukilkesi C) Sırsaklamailkesi D) Gerçeğeuymailkesi E) Sözcülükilkesi 3. Aşağıdakilerdenhangisietikkararvermesürecininaşamalarındandeğildir? A) Durumu değerlendirme B) Sorunuadlandırma C) Alternatifhareketşekilleri D) Tamamlamak E) Uygulamak CevapAnahtarı -A, 2-B, 3-E 73

174 Dersin Kazanımları Okul Program Ders Konu Kazanım Kodu KaynakKitap AyşegülDemirhanErdemir, TıbbiDeontolojiveGenelTıpTarihi, Güneşve Nobel Yayınları YardımcıKaynaklarve Okuma Listesi MeslekOlarakHemşirelikveHemşirelikteEtikİlkeler Ürünkodu: Yayınevi: Nobel TıpKitabevi Öğretim Üyesi FTP-22 PSİKOSOSYAL REHABİLİTASYON Elif BAYAZIT Oda Numarası E-posta Ders Zamanı Derslik Dersin Amacı Fiziksel, duyusal yada kognitif yönden herhangi bir nedenle engel, özür yada bozukluk durumunda bireyin psikososyal tablosunun anlaşılabilmesini sağlamak, psikososyal sürece etki eden durumların kavratmak ve fizyoterapi ve rehabilitasyon uygulamalarında karşılaşılabilecek psikososyal problemlerin göz önüne alarak rehabilitasyon programını yönlendirebilme becerisini kazandırmaktır Konu ve ilgili kazanım 39 7 FTP FTP23.. Giriş ve Psikososyal rehabilitasyon alanında kavramlar 39 7 FTP FTP23.. Psikososyal rehabilitasyon tanımlar FTP FTP23..2 Psikososyal rehabilitasyon alanında kavramları kavrar FTP FTP23..3 Psikososyal rehabilitasyon kapsamındaki hasta gruplarını bilir FTP FTP23.2. Kaza sonrası yaşanan psikososyal süreç ve uyum aşamaları 39 7 FTP FTP Kaza sonrası yaşanan psikososyal süreçleri öğrenir FTP FTP23.2. Kaza sonrası yaşanan psikososyalsüreçdeki uyum aşamalarını bilir FTP FTP Hastaya uygun rehabilitasyon basamaklarını bilir FTP FTP23.3. Stres ve posttravmatik stres bozukluğu 39 7 FTP FTP Stres bozukluğunu tanımlar FTP FTP Postravmatik stres bozukluğunu tanımlar FTP FTP Hastaya uygun rehabilitasyon basamaklarını bilir FTP FTP23.4. Travmatik yaralanmalardan sonra görülen problemlerde (amputeler, omurilik yaralanmaları, yanık 74

175 )psikososyalrehabilitasyon 39 7 FTP FTP23.4. Travmatik yaralanmalardan sonra görülen problemleri öğrenir FTP FTP23.4. Probleme uygun rehabilitasyon protokolunu öğrenir FTP FTP Hastanın rehabilitasyona uyumunu sağlar FTP FTP23.. Nörolojik hastalıklarda psikososyal rehabilitasyon (hemipleji, parkinson, MS) 39 7 FTP FTP22..3 Nörolojik hastalıklarda görülen psikososyalprobleri tanımlar FTP F FTP22..4 Hemiplejidepsikosoyal rehabilitasyon basamaklarını bilir FTP FTP22.. MS de psikosoyal rehabilitasyon basamaklarını bilir FTP FTP22.6. Çocuklarda özüre neden olan problemlerde psikososyal rehabilitasyon (serebral paralizi, kas hastalıkları, otistik çocuklar, down sendromu 39 7 FTP FTP Çocuklarda özüre neden olan problemleri bilir FTP FTP Çocuklarda psikosasyla rehabilitasyon basamaklarını bilir FTP FTP Çocuğu rehabilitasyon programına adapte edebilir FTP FTP22.7. İlerleyici kronik hastalıklarda (kanser, AIDS), geriatrik kişilerde psikososyal rehabilitasyon 39 7 FTP FTP İlerleyici kronik hastalık sebeplerini bilir FTP FTP Kronik hastalıklarda psikosasyal rehabilitasyon basamaklarını bilir FTP FTP Kronik hastalığa uygun rehabilitasyon uygulamasını yapabilir FTP FTP22.8. Fiziksel engellilerde psikosoyal süreç üzerine interaktif katılımlı tartışma 39 7 FTP FTP Fiziksel engeldeki psikososyal süreçleri bilir FTP FTP Rehabilitasyon ekibini tanımlar FTP FTP Multidispliner yaklaşımdaki yerini bilir FTP FTP22.9. Engelli çocuğa sahip ailelerde psikosoyal süreç üzerine interaktif katılımlı tartışma 39 7 FTP FTP Ailenin psikososyal açıdan yaşadığı problemleri bilir FTP FTP Aileyi rehabilitasyon çalışmasına dahil edebilir FTP FTP İnteraktif katılımlı çalışmayı uygulayabilir FTP FTP22.. Görme engellilerde psikosoyal süreç üzerine interaktif katılımlı tartışma 39 7 FTP FTP Görme engellilerde yaşanan psikosasyla süreçleri bilir FTP FTP Rehabilitasyon ekibini tanır FTP FTP23..3 İnteraktif katılımlı çalışmayı uygulayabilir FTP FTP22.. İşitme-konuşma engellilerde psikosoyal süreç üzerine interaktif katılımlı tartışma 39 7 FTP FTP22..3 İşitme engellilerdeki psikososyal süreçleri bilir FTP FTP Konuşma engellilerdekipsikososyal süreçleri bilir FTP FTP Uygun rehabilitasyon yaklaşımlarını uygulayabilir FTP FTP22.2. Depresyon ve başa çıkma yolları 39 7 FTP FTP Depresyonu tanımlar 39 7 FTP FTP Depresyon durumunda psikosasyal rehabilitasyon basamaklarını bilir ve uygular. Hafta-Tarih Ders Konuları İlgili Program Yeterliği -4 Şubat 22 Uyum Haftası Şubat 22 Giriş ve Psikososyal rehabilitasyon alanında kavramlar PY Şubat 22 Kaza sonrası yaşanan psikososyal süreç ve uyum aşamaları PY-PY Mart 22 Stres ve posttravmatik stres bozukluğu PY-PY 7

176 9-3 Mart 22 Travmatik yaralanmalardan sonra görülen problemlerde (amputeler, omurilik yaralanmaları, yanık )psikososyal PY-PY rehabilitasyon Mart 22 Nörolojik hastalıklarda psikososyal rehabilitasyon (hemipleji, parkinson, MS) PY-PY Mart 22 Çocuklarda özüre neden olan problemlerde psikososyal rehabilitasyon (serebral paralizi, kas hastalıkları, otistik çocuklar, PY-PY down sendromu) 28 Mart- Nisan 22 ARA SINAV 8 6- Nisan 22 İlerleyici kronik hastalıklarda (kanser, AIDS), geriatrik kişilerde psikososyal rehabilitasyon PY-PY Nisan 22 Fiziksel engellilerde psikosoyal süreç üzerine interaktif katılımlı tartışma PY-PY 2-24 Nisan 22 Engelli çocuğa sahip ailelerde psikosoyal süreç üzerine interaktif katılımlı tartışma PY-PY 27 Nisan- Mayıs 22 Görme engellilerde psikosoyal süreç üzerine interaktif katılımlı tartışma PY-PY Mayıs 22 İşitme-konuşma engellilerde psikosoyal süreç üzerine interaktif katılımlı tartışma PY-PY2 3 - Mayıs 22 Depresyon ve başa çıkma yolları PY-PY Mayıs 22 Fiziksel engellilerde psikosoyal süreç üzerine interaktif katılımlı tartışma PY-PY2 3 Mayıs-7 Haziran 22 Dönem Sonu Sınavları -2 Haziran 22 Bütünleme Sınavları Bu dersin değerlendirmesi, kaynak kitaplar ve derste yürütülen tartışmalar esas Değerlendirme alınarak hazırlanacak olan çoktan seçmeli bir vize ve bir final aracılığıyla yapılacaktır. Vizenin ortalamaya katkısı % 4 finalinki ise % 6 tır. Geçme notu üzerinden 6 tır. ) Aşağıdakilerden hangisi sağlığı geliştirme davranışlarının getirdiği sonuçlar arasında ver almaz? a) Genetik özelliklerin değişmesi b)sağlıkdüeyinin yükselmesi c)kronik hastalıkların başlama yaşının gecikmesi d)yaşam süresinin uzaması Örnek Sorular 2) Etkili bir psiko-sosyal rehabilitasyon hizmetinin özellikleri ile ilgili aşağıdaki ifadelerden hangisi yanlıştır? a)aile ile işbirliği içinde sürdürülmelidir. b)günlük yaşamı etkilemeyeck şekilde sürdürülmelidir. c)bireyin mevcut özellikleri göz önünde bulundurulmalıdır. d)uzmanın belirlediği hedefler doğrultusunda çalışmlar yürütülmelidir. Cevap Anahtarı -) A 2-) D Kaynak Kitap French S. Physiotherapy a PsychosocialApproach, ButterworthHeinemann, Oxford Boston,

YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ. FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ. ZORUNLU ve SEÇMELİ DERSLER 1.

YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ. FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ. ZORUNLU ve SEÇMELİ DERSLER 1. YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ ZORUNLU ve SEÇMELİ DERSLER 1. YARIYIL (GÜZ) TAR 101 Atatürk İlkeleri ve İnkilap Tarihi I 2 0 2 2 Zorunlu TUR

Detaylı

YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ. FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ. ZORUNLU ve SEÇMELİ DERSLER 1.

YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ. FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ. ZORUNLU ve SEÇMELİ DERSLER 1. YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ ZORUNLU ve SEÇMELİ DERSLER 1. YARIYIL (GÜZ) TAR 101 Atatürk İlkeleri ve İnkilap Tarihi I 2 0 2 2 Zorunlu TUR

Detaylı

T.C. İSTANBUL RUMELİ ÜNİVERSİTESİ SAĞLI BİLİMLERİ YÜKSEKOKULU FİZYOTERAPİ VE REHABİLİTASYON BÖLÜMÜ 1. Sınıf Güz Dönemi Ders Programı

T.C. İSTANBUL RUMELİ ÜNİVERSİTESİ SAĞLI BİLİMLERİ YÜKSEKOKULU FİZYOTERAPİ VE REHABİLİTASYON BÖLÜMÜ 1. Sınıf Güz Dönemi Ders Programı T.C. İSTANBUL RUMELİ ÜNİVERSİTESİ SAĞL BİLİMLERİ YÜKSEKOKULU 1. Sınıf Güz Dönemi Ders Programı Cumartesi Yabancı Dil Tıbbi Terminoloji Yabancı Dil Pratik Temel Fizik 10.15-11.00 Yabancı Dil Tıbbi Terminoloji

Detaylı

İZMİR BAKIRÇAY ÜNİVERSİTESİ

İZMİR BAKIRÇAY ÜNİVERSİTESİ T.C. İZMİR BAKIRÇAY ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ FİZYOTERAPİ VE REHABİLİTASTON BÖLÜMÜ DERS PLANI 1. Yarıyıl Ders Planı FTR101 Anatomi I 4 4 6 FTR103 Fizyoloji I 4 0 4 FTR105 İlkyardım 2 0 3

Detaylı

NUH NACİ YAZGAN ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ FİZYOTERAPİ VE REHABİLİTASYON BÖLÜMÜ EĞİTİM ÖĞRETİM YILI DERS PROGRAMI

NUH NACİ YAZGAN ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ FİZYOTERAPİ VE REHABİLİTASYON BÖLÜMÜ EĞİTİM ÖĞRETİM YILI DERS PROGRAMI NUH NACİ YAZGAN ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ FİZYOTERAPİ VE REHABİLİTASYON BÖLÜMÜ 2016-2017 EĞİTİM ÖĞRETİM YILI DERS PROGRAMI 1.SINIF/1. YARIYIL FTR 101 Fizyoterapiye Giriş ve Etik Zorunlu 2+0+2

Detaylı

T.C. İSTANBUL BİLİM ÜNİVERSİTESİ SAĞLIK YÜKSEKOKULU BESLENME VE DİYETETİK BÖLÜMÜ EĞİTİM - ÖĞRETİM YILI GÜZ YARIYILI ARA SINAVI

T.C. İSTANBUL BİLİM ÜNİVERSİTESİ SAĞLIK YÜKSEKOKULU BESLENME VE DİYETETİK BÖLÜMÜ EĞİTİM - ÖĞRETİM YILI GÜZ YARIYILI ARA SINAVI BESLENME VE DİYETETİK BÖLÜMÜ 2012-2013 EĞİTİM - ÖĞRETİM YILI GÜZ YARIYILI ARA SINAVI 07.01.2013 Pazartesi 9-10-11 09.00 İngilizce-I 08.01.2013 Salı 9-10-11 09.00 Beslenmeye Giriş 09.01.2013 Çarşamba 9-10-11

Detaylı

Pazartesi BES LAB 10:00 Çocuk (Uygulama) 11:00 Yetişkin (Uygulama)

Pazartesi BES LAB 10:00 Çocuk (Uygulama) 11:00 Yetişkin (Uygulama) SAĞLIK YÜKSEKOKULU BESLENME VE DİYETETİK BÖLÜMÜ 2012-2013 EĞİTİM - ÖĞRETİM YILI BAHAR YARIYILI ARA SINAV TAKVİMİ 22.04.2013 Pazartesi 9-10-11 8.30 Psikoloji ve Davranış Bilimi 22.04.2013 Pazartesi 9-10-11

Detaylı

I. SINIF İngilizce-I Tıbbi Biyoloji ve Genetik-I Salı Beslenmeye Giriş

I. SINIF İngilizce-I Tıbbi Biyoloji ve Genetik-I Salı Beslenmeye Giriş BESLENME VE DİYETETİK BÖLÜMÜ 11 09.00 İngilizce-I 9 10.00 Tıbbi Biyoloji ve Genetik-I 05.02.2013 Salı 10-11 09.00 Beslenmeye Giriş 06.02.2013 Çarşamba 08.02.2013 Cuma 05.02.2013 Salı 9 9 09.00 Psikolojiye

Detaylı

YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ. FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ. ZORUNLU ve SEÇMELİ DERSLER 1.

YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ. FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ. ZORUNLU ve SEÇMELİ DERSLER 1. YÜKSEK İHTİSAS ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ ZORUNLU ve SEÇMELİ DERSLER 1.YARIYIL (GÜZ) ADI Teorik Pratik Kredi AKTS ANA 101 Anatomi I 4 2 5 5 Zorunlu TAR

Detaylı

FTR 2005 Fizyoterapide Ölçme ve Değerlendirme 2 3 4 2 0 6 Z

FTR 2005 Fizyoterapide Ölçme ve Değerlendirme 2 3 4 2 0 6 Z MUĞLA SITKI KOÇMAN ÜNĠVERSĠTESĠ MUĞLA SAĞLIK YÜKSEKOKULU FĠZYOTERAPĠ VE REHABĠLĠTASYON BÖLÜMÜ Ders Kodu Ders Adı Sınıf Yarıyıl Kredi 1 1 T U L K Z/S ATB 1801 Atatürk İlkeleri ve İnk. Tarihi - I 1 1 2 0

Detaylı

GÜZEL SANATLAR (Resim, Müzik vb) 2 0 S

GÜZEL SANATLAR (Resim, Müzik vb) 2 0 S TIBBİ LABORATUVAR TEKNİKLERİ PROGRAMI DERS PLANI ANATOMİ 6703101 2 0 Z 3 TÜRK DİLİ I 6703109 2 0 Z 2 YABANCI DİL I 6703110 2 0 Z 2 ATATÜRK İLKELERİ VE İNKILAP TARİHİ I 6703114 2 0 Z 2 GENEL BİYOLOJİ 6703121

Detaylı

III. SINIF (1. Hafta) III. SINIF (2. Hafta)

III. SINIF (1. Hafta) III. SINIF (2. Hafta) SAĞLIK YÜKSEKOKULU BESLENME ve DİYETETİK BÖLÜMÜ 21.11.2011 Pazartesi 10 09.00 Temel Kimya 22.11.2011 Salı 10 10.00 Temel Matematik 23.11.2011 Çarşamba 10 11.00 Halk Sağlığı- I 24.11.2011 Perşembe 10-13

Detaylı

03-07 Eylül 2018 Bölümler tarafından ders programlarının belirlenmesi. 21 Eylül 2018 Yabancı Uyruklu Öğrenciler için Türkçe Yeterlik Sınavı

03-07 Eylül 2018 Bölümler tarafından ders programlarının belirlenmesi. 21 Eylül 2018 Yabancı Uyruklu Öğrenciler için Türkçe Yeterlik Sınavı 03-10 Eylül 2018 19 Eylül 2018 03-23 Eylül 2018 12 Eylül 2018 2018-2019 EĞİTİM-ÖĞRETİM YILI GENEL AKADEMİK TAKVİMİ GÜZ YARIYILI İsteğe bağlı olarak İngilizce Hazırlık sınıfı okuyacak öğrenciler için Yabancı

Detaylı

Fizyoterapi ve Rehabilitasyon Programı Müfredat

Fizyoterapi ve Rehabilitasyon Programı Müfredat ve Programı Müfredat Kodu Adı Tipi * Yeni Öğrenci için KSTU101 NC 3 Oryantasyon Programı * Bu 3 günlük program yeni kayıtlı lisans öğrencilerinin akademik, kültürel ve sosyal hayata adaptasyonu için organize

Detaylı

Kıbrıs Sağlık ve Toplum Bilimleri Üniversitesi Fizyoterapi ve Rehabilitasyon Programı. Müfredat

Kıbrıs Sağlık ve Toplum Bilimleri Üniversitesi Fizyoterapi ve Rehabilitasyon Programı. Müfredat Kıbrıs Sağlık ve Toplum Bilimleri Üniversitesi ve Programı Müfredat Kodu Adı Tipi * Yeni Öğrenci için KSTU101 NC 3 Oryantasyon Programı * Bu 3 günlük program yeni kayıtlı lisans öğrencilerinin akademik,

Detaylı

BOZOK ÜNİVERSİTESİ FAKÜLTE/YÜKSEKOKUL/MESLEK YÜKSEKOKULU/ENSTİTÜLERİN EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ GÜZ YARIYILI

BOZOK ÜNİVERSİTESİ FAKÜLTE/YÜKSEKOKUL/MESLEK YÜKSEKOKULU/ENSTİTÜLERİN EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ GÜZ YARIYILI BOZOK ÜNİVERSİTESİ FAKÜLTE/YÜKSEKOKUL/MESLEK YÜKSEKOKULU/ENSTİTÜLERİN - EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ GÜZ YARIYILI 19.06.-14.07. Yabancı Uyruklu Öğrencilerin Başvuruları (Lisans ve Önlisans) 10.07.-21.07.

Detaylı

AVRASYA ÜNİVERSİTESİ

AVRASYA ÜNİVERSİTESİ Dersin Adı Öğretim Dili İş ve Uğraşı Fizyolojisi Türkçe Dersin Verildiği Düzey Ön Lisans (x) Lisans ( ) Yüksek Lisans( ) Doktora( ) Eğitim Öğretim Sistemi Örgün Öğretim ( X) Uzaktan Öğretim( ) Diğer (

Detaylı

24-27 Temmuz 2017 Pazartesi-Perşembe

24-27 Temmuz 2017 Pazartesi-Perşembe İSTANBUL YENİ YÜZYIL ÜNİVERSİTESİ 2017-2018 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ GÜZ DÖNEMİ 8 Mayıs - 28 Temmuz 2017 Pazartesi-Cuma Yurtdışı Öğrenci Başvuruları 7 Ağustos 2017 Pazartesi Yurtdışı Öğrenci

Detaylı

TIBBİ HİZMETLER VE TEKNİKLER BÖLÜMÜ TIBBİ LABORATUVAR TEKNİKLERİ PROGRAMI DERS PLANI DÖNEM KOD DERSİN ADI TEORİK UYG. AKTS

TIBBİ HİZMETLER VE TEKNİKLER BÖLÜMÜ TIBBİ LABORATUVAR TEKNİKLERİ PROGRAMI DERS PLANI DÖNEM KOD DERSİN ADI TEORİK UYG. AKTS TIBBİ LABORATUVAR TEKNİKLERİ PROGRAMI DERS PLANI 6703101 ANATOMİ 2 0 3 6703109 TÜRK DİLİ I 2 0 2 6703110 YABANCI DİL I 2 0 2 6703114 ATATÜRK İLKELERİ VE İNKILAP TARİHİ I 2 0 2 6703121 GENEL BİYOLOJİ 3

Detaylı

Tarihler Lisans Lisansüstü

Tarihler Lisans Lisansüstü 2016-2017 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ Tarihler Lisans Lisansüstü 03 Haziran 2016 Fakülteler Tarafından ÖİDB ye; 2016-2017 Güz Yarıyılı Yandal Kontenjanlarının Bildirilmesi İçin Son Gün 23 Mayıs-06

Detaylı

İSTANBUL YENİ YÜZYIL ÜNİVERSİTESİ EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİM v.7

İSTANBUL YENİ YÜZYIL ÜNİVERSİTESİ EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİM v.7 GÜZ DÖNEMİ Tarih Gün İşlem 8 Mayıs - 28 Temmuz 2017 Pazartesi-Cuma Yurtdışı Öğrenci Başvuruları 7 Ağustos 2017 Pazartesi Yurtdışı Öğrenci Türkçe Seviye Tespit Sınavı 14-17 Ağustos 2017 Pazartesi-Perşembe

Detaylı

GÜZ DÖNEMİ BAHAR DÖNEMİ

GÜZ DÖNEMİ BAHAR DÖNEMİ 2014-2015 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ ÖNLİSANS VE LİSANS PROGRAMLARI (Tıp ve Veteriner Fakülteleri ile Yabancı Diller Yüksekokulu Hariç) GÜZ DÖNEMİ 01-05 Eylül 2014 ÖSYM tarafından önlisans ve

Detaylı

T.C. İSTANBUL BİLİM ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ BESLENME VE DİYETETİK BÖLÜMÜ EĞİTİM-ÖĞRETİM YILI MÜFREDAT

T.C. İSTANBUL BİLİM ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ BESLENME VE DİYETETİK BÖLÜMÜ EĞİTİM-ÖĞRETİM YILI MÜFREDAT SAĞLIK BİLİMLERİ FAKÜLTESİ BESLENME VE DİYETETİK BÖLÜMÜ 2018-2019 EĞİTİM-ÖĞRETİM YILI MÜFREDAT 1. SINIF 1.SINIF l. YARIYIL (Güz) (01) Kodu Z/S Dersin Adı T U L K Z BESLENMEYE GİRİŞ 3 0 0 3 4 Z TEMEL KİMYA-I

Detaylı

2015-2016 DERS YILI AKADEMİK TAKVİMİ

2015-2016 DERS YILI AKADEMİK TAKVİMİ 2015-2016 DERS YILI AKADEMİK TAKVİMİ 2015-2016 Güz Yarıyılı 16 Temmuz 2015 (Perşembe, Arife, ½ gün) 17-19 Temmuz 2015 (Cuma-Pazar) Ramazan Bayramı (Tatil) 20-23 Temmuz 2015 (Pazartesi-Perşembe, Saat: 10:00)

Detaylı

ĠSTANBUL YENĠ YÜZYIL ÜNĠVERSĠTESĠ EĞĠTĠM ÖĞRETĠM YILI AKADEMĠK TAKVĠM GÜZ DÖNEMĠ

ĠSTANBUL YENĠ YÜZYIL ÜNĠVERSĠTESĠ EĞĠTĠM ÖĞRETĠM YILI AKADEMĠK TAKVĠM GÜZ DÖNEMĠ ĠSTANBUL YENĠ YÜZYIL ÜNĠVERSĠTESĠ 2018-2019 EĞĠTĠM ÖĞRETĠM YILI AKADEMĠK TAKVĠM GÜZ DÖNEMĠ Tarih Gün İşlem 4 Haziran - 27 Temmuz 2018 Pazartesi-Cuma Yurtdışı Öğrenci Başvuruları 6 Ağustos 2018 Pazartesi

Detaylı

2014-2015 YILI ÖNLİSANS VE LİSANS AKADEMİK TAKVİMİ 2014-2015 GÜZ YARIYILI

2014-2015 YILI ÖNLİSANS VE LİSANS AKADEMİK TAKVİMİ 2014-2015 GÜZ YARIYILI 2014-2015 YILI ÖNLİSANS VE LİSANS AKADEMİK TAKVİMİ TARİH GÜN İŞLEM 12 Mayıs - 15 Ağustos 2014 Pazartesi-Cuma Yurtdışı Öğrenci Başvuruları 16 Haziran - 25 Temmuz 2014 Pazartesi - Cuma Kurumlararası Yatay

Detaylı

DERS YEREL KREDİSİ DERS ADI

DERS YEREL KREDİSİ DERS ADI KATALOĞU 1. YIL / 1. YARIYIL SAATİ YEREL ADI TİPİ TEORİK UYGULAMA TOPLAM KREDİ MFZ 101 Fizyoterapide Temel Ölçme ve Değerlendirme Z 3 2 5 4 6 MFZ 103 Fizyoterapiye Giriş Z 2 0 2 2 2 MFZ 105 Anatomi-I Z

Detaylı

CANİK BAŞARI ÜNİVERSİTESİ HAZIRLIK SINIFI EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ BAŞLAMA BİTİŞ AKADEMİK FAALİYET 03 Ağustos 2015 Pazartesi

CANİK BAŞARI ÜNİVERSİTESİ HAZIRLIK SINIFI EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ BAŞLAMA BİTİŞ AKADEMİK FAALİYET 03 Ağustos 2015 Pazartesi CANİK BAŞARI ÜNİVERSİTESİ HAZIRLIK SINIFI 20152016 EĞİTİMÖĞRETİM YILI AKADEMİK TAKVİMİ BAŞLAMA BİTİŞ AKADEMİK FAALİYET 03 Ağustos 2015 07 Ağustos 2015 Asıl Kayıt /Düzey Belirleme Sınavı 31 Ağustos 2015

Detaylı

ORTOPEDİK VE SPORDA REHABİLİTASYON. Uygulama. Dersin Adı Kodu Yarıyıl Teori AKTS. (saat/hafta) (saat/hafta) (saat/hafta) 2 2-3 FTR

ORTOPEDİK VE SPORDA REHABİLİTASYON. Uygulama. Dersin Adı Kodu Yarıyıl Teori AKTS. (saat/hafta) (saat/hafta) (saat/hafta) 2 2-3 FTR ORTOPEDİK VE SPORDA REHABİLİTASYON Dersin Adı Kodu Yarıyıl Teori Laboratuar AKTS Ortopedik ve Sporda Rehabilitasyon FTR 313 3.YIL/ 1.yarıyıl Güz (saat/hafta) (saat/hafta) (saat/hafta) 2 2-3 Önkoşullar

Detaylı

FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ EĞİTİM ÖĞRETİM YILI BİTİRME TELAFİ SINAVI

FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ EĞİTİM ÖĞRETİM YILI BİTİRME TELAFİ SINAVI FİZYOTERAPİ ve REHABİLİTASYON BÖLÜMÜ 2010-2011 EĞİTİM ÖĞRETİM YILI BİTİRME TELAFİ SINAVI 08.07.2011 Cuma 08.07.2011 Cuma 08.07.2011 701 10:00 Biyokimya 701 11:00 Fizyoterapi ve Rehabilitasyonda Metodoloji

Detaylı

YURTDIŞI VEYA YABANCI UYRUKLU ÖĞRENCİ BAŞVURU VE KAYIT TAKVİMİ

YURTDIŞI VEYA YABANCI UYRUKLU ÖĞRENCİ BAŞVURU VE KAYIT TAKVİMİ GAZİOSMANPAŞA ÜNİVERSİTESİ 2014-2015 EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ GUZ YARIYILI Yeni kayıtlar 1-5 Eylül 2014 Ders Kayıtları (İnternet Üzerinden) 08-14 Eylül 2014 Danışman Onayı 15-17 Eylül 2014

Detaylı

AVRASYA ÜNİVERSİTESİ

AVRASYA ÜNİVERSİTESİ Dersin Adı Öğretim Dili Yaşam Boyu Spor Türkçe Dersin Verildiği Düzey Ön Lisans (x) Lisans ( ) Yüksek Lisans( ) Doktora( ) Eğitim Öğretim Sistemi Örgün Öğretim ( X) Uzaktan Öğretim( ) Diğer ( ) Dersin

Detaylı

ABDİ SÜTCÜ SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU Ağız ve Diş Sağlığı Öğretim Yılı Ders Planı

ABDİ SÜTCÜ SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU Ağız ve Diş Sağlığı Öğretim Yılı Ders Planı Ağız ve Diş Sağlığı DS 103 Ortodontide Klinik Yardımcılığı 3 3+0 3 DS 105 Protetik Diş Tedavisinde Klinik Yardımcılığı ve Dental Terminoloji 2 2+0 2 DS 129 Meslekte Temel İlke Ve Uygulamalar 2.5 1+3 2

Detaylı

T.C. DÜZCE ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ. Yeni Hali YATAY GEÇİŞ BAŞVURULARI TEMMUZ 2018

T.C. DÜZCE ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ. Yeni Hali YATAY GEÇİŞ BAŞVURULARI TEMMUZ 2018 T.C. DÜZCE ÜNİVERSİTESİ TIP FAKÜLTESİ 2018 2019 EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ Yeni Hali YATAY GEÇİŞ BAŞVURULARI 23-27 TEMMUZ 2018 YENİ ÖĞRENCİ KAYITLARI ÖSYM tarafından belirlenecek DÖNEM I HÜCRE

Detaylı

T.C. ÖSS, TCS, Anlaşmalı Üniversiteler Aracılığıyla Yerleştirilen Öğrencilerin Kayıtları 05 Eylül 2008 Cuma

T.C. ÖSS, TCS, Anlaşmalı Üniversiteler Aracılığıyla Yerleştirilen Öğrencilerin Kayıtları 05 Eylül 2008 Cuma YABANCI DİLLER YÜKSEKOKULU (ÖNLİSANS ve LİSANS HAZIRLIK SINIFLARININ) GÜZ YARIYILI 21 Temmuz 2008 Pazartesi 25 Temmuz 2008 Cuma Manas ÖSS ile Üniversiteye Yerlestirilen Öğrencilerin Kayıtları 01 Eylül

Detaylı

HARRAN ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ

HARRAN ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ TIP FAKÜLTESİ 2018 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ 1. SINIF 10 16 Eylül 2018 Ders Kayıtları ve Öğrenci Katkı Paylarının I. Taksitinin Ödenmesi (Normal Eğitim 17 Eylül 2018 1. Yarıyıl Derslerinin Başlaması

Detaylı

AVRASYA ÜNİVERSİTESİ

AVRASYA ÜNİVERSİTESİ Dersin Adı Öğretim Dili Pediatrik Rehabilitasyon Türkçe Dersin Verildiği Düzey Ön Lisans (x) Lisans ( ) Yüksek Lisans( ) Doktora( ) Eğitim Öğretim Sistemi Örgün Öğretim ( X) Uzaktan Öğretim( ) Diğer (

Detaylı

AVRASYA ÜNİVERSİTESİ

AVRASYA ÜNİVERSİTESİ Dersin Adı Öğretim Dili Ergonomi Türkçe Dersin Verildiği Düzey Ön Lisans (x) Lisans ( ) Yüksek Lisans( ) Doktora( ) Eğitim Öğretim Sistemi Örgün Öğretim ( X) Uzaktan Öğretim( ) Diğer ( ) Dersin Türü Dersin

Detaylı

SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU Ortopedik Protez ve Ortez Programına İlişkin Bilgiler

SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU Ortopedik Protez ve Ortez Programına İlişkin Bilgiler SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU Ortopedik Protez ve Ortez Programına İlişkin Bilgiler Genel Bilgi Kas-iskelet sistemi rahatsızlıklarının tedavisinde sıklıkla kullanılan ortopedik protez ve ortezlerin

Detaylı

T.C. MERSİN ÜNİVERSİTESİ Eğitim-Öğretim Yılı Akademik Takvimi

T.C. MERSİN ÜNİVERSİTESİ Eğitim-Öğretim Yılı Akademik Takvimi T.C. MERSİN ÜNİVERSİTESİ 2017-2018 Eğitim-Öğretim Yılı Akademik Takvimi Eğitim Öğretim Dönemi Başlangıç Bitiş 2017-2018 Eğitim-Öğretim Akademik Yılı 01.09.2017 30.08.2018 2017-2018 Eğitim Öğretim Akademik

Detaylı

HARRAN ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM ve ÖĞRETİM YILI AKADEMİK TAKVİMİ

HARRAN ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM ve ÖĞRETİM YILI AKADEMİK TAKVİMİ TIP FAKÜLTESİ 2018 2019 EĞİTİM ve ÖĞRETİM YILI AKADEMİK TAKVİMİ 1. SINIF 10 16 Eylül 2018 Ders Kayıtları ve Öğrenci Katkı Paylarının I. Taksitinin Ödenmesi (Normal Eğitim 17 Eylül 2018 1. Yarıyıl Derslerinin

Detaylı

T.C. İSTANBUL AYDIN ÜNİVERSİTESİ EĞİTİM - ÖĞRETİM YILI AKADEMİK TAKVİMİ

T.C. İSTANBUL AYDIN ÜNİVERSİTESİ EĞİTİM - ÖĞRETİM YILI AKADEMİK TAKVİMİ Akademik Takvim T.C. İSTANBUL AYDIN ÜNİVERSİTESİ 2017-2018 EĞİTİM - ÖĞRETİM YILI AKADEMİK TAKVİMİ Önlisans, Lisans ve Lisansüstü GÜZ YARIYILI UZAKTAN EĞİTİM (Önlisans ve Lisansüstü) DİŞ HEKİMLİĞİ FAKÜLTESİ

Detaylı

AKDENİZ ÜNİVERSİTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİM

AKDENİZ ÜNİVERSİTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİM AKDENİZ ÜNİVERSİTESİ 2018-2019 EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİM Ön Lisans ve Lisans Eğitim Öğretim Güz Yarıyılı Yeni Öğrencilerin Kesin Kayıtları ve Yeterlilik Sınavları Bahar Yarıyılı 03-05 Eylül 2018

Detaylı

2014-2015 BAHAR DÖNEMİ FİNAL PROGRAMI

2014-2015 BAHAR DÖNEMİ FİNAL PROGRAMI 2014-2015 BAHAR DÖNEMİ FİNAL PROGRAMI Ders Kodu Ders Adı Öğretim Elemanı Ünvanı / Adı Dersin Açıldığı Bölüm/Bölümler Öğrenci sayısı Gün Başlangıç Saati Bitiş Saati Derslik BES102 Beslenme İlkeleri II Yrd.Doç.Dr.Funda

Detaylı

Güz dönemi kurum içi yatay geçiş başvuralarının internet üzerinden duyurulması Eylül 2016 Pazartesi -

Güz dönemi kurum içi yatay geçiş başvuralarının internet üzerinden duyurulması Eylül 2016 Pazartesi - 2016-2017 AKADEMİK TAKVİM GÜZ DÖNEMİ 05-07 Temmuz 2016 Salı - Ramazan Bayramı tatili (Arife: 04 Temmuz Pazartesi) 01-31 Ağustos 2016 Pazartesi - Lisansüstü güz dönemi başvuruları 01-31 Ağustos 2016 Pazartesi

Detaylı

GÜZ YARIYILI - 24 Eylül - 30 Aralık 2018

GÜZ YARIYILI - 24 Eylül - 30 Aralık 2018 "Önceki Öğrenmelerin Tanınması" sınavları için başvuru 3-4 - 5 Eylül 2018 Başvuru değerlendirmelerinin ve sınavların uygulanma şekillerinin ilanı 07 Eylül 2018 Cuma Sınavların uygulanması 10-11 Eylül 2018

Detaylı

SANKO ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ BESLENME VE DİYETETİK BÖLÜMÜ

SANKO ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ BESLENME VE DİYETETİK BÖLÜMÜ SANKO ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ BESLENME VE DİYETETİK BÖLÜMÜ Programın Amacı SANKO Üniversitesi Beslenme ve Diyetetik Bölümü programı sağlığın korunmasında, hastalıkların iyileştirilmesinde,

Detaylı

KIRGIZİSTAN-TÜRKİYE MANAS ÜNİVERSİTESİ 2009 2010 EĞİTİM-ÖĞRETİM YILI HAZIRLIK SINIFLARI AKADEMİK TAKVİMİ GÜZ YARIYILI

KIRGIZİSTAN-TÜRKİYE MANAS ÜNİVERSİTESİ 2009 2010 EĞİTİM-ÖĞRETİM YILI HAZIRLIK SINIFLARI AKADEMİK TAKVİMİ GÜZ YARIYILI HAZIRLIK SINIFLARI GÜZ YARIYILI 27 Temmuz 2009 Pazartesi Manas ÖSS ile Üniversiteye Yerleştirilen Öğrencilerin 31 Temmuz 2009 Cuma Kayıtları 01 Eylül 2009 Salı Bilim ve Üniversitenin Resmi Açılışı 01 Eylül

Detaylı

EĞĠTĠM ÖĞRETĠM YILI AKADEMĠK TAKVĠM. Güz Yarıyılı Yeni Öğrencilerin Kesin Kayıtları ve Yeterlik Sınavları Bahar Yarıyılı

EĞĠTĠM ÖĞRETĠM YILI AKADEMĠK TAKVĠM. Güz Yarıyılı Yeni Öğrencilerin Kesin Kayıtları ve Yeterlik Sınavları Bahar Yarıyılı 2015- EĞĠTĠM ÖĞRETĠM YILI AKADEMĠK TAKVĠM Güz Yarıyılı Yeni Öğrencilerin Kesin Kayıtları ve Yeterlik Sınavları Bahar Yarıyılı 3-7 Ağustos 2015 Yeni Öğrencilerin Kayıtlarının Yapılması 24-28 Ağustos 2015

Detaylı

T.C. MERSİN ÜNİVERSİTESİ Eğitim-Öğretim Yılı Akademik Takvimi

T.C. MERSİN ÜNİVERSİTESİ Eğitim-Öğretim Yılı Akademik Takvimi T.C. MERSİN ÜNİVERSİTESİ 2016-2017 Eğitim-Öğretim Yılı Akademik Takvimi Eğitim Öğretim Dönemi Başlangıç Bitiş 2016-2017 Eğitim-Öğretim Akademik Yılı 01.09.2016 30.08.2017 2017-2018 Eğitim-Öğretim Akademik

Detaylı

HARRAN ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ

HARRAN ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ TIP FAKÜLTESİ 2018 2019 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ 1. SINIF 10 16 Eylül 2018 Ders Kayıtları ve Öğrenci Katkı Paylarının I. Taksitinin Ödenmesi 17 Eylül 2018 1. Yarıyıl Derslerinin Başlaması 18

Detaylı

2013-2014 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ

2013-2014 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ 2013-2014 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ»» Üniversitemizin Tıp Fakültesi, Diş Hekimliği, Sağlık Bilimleri Fakültesi, Yabancı Diller Yüksek Okulu haricindeki bütün birimlerinde Normal Öğretim ve İkinci

Detaylı

REKTÖRLÜK MAKAMI Öğrenci İşleri Daire Başkanlığına

REKTÖRLÜK MAKAMI Öğrenci İşleri Daire Başkanlığına T.C. KARADENİZ TEKNİK ÜNİVERSİTESİ REKTÖRLÜĞÜ DİŞ HEKİMLİĞİ FAKÜLTESİ DEKANLIĞI Sayı : 64529847-03/12/2015 Konu : 2016-2017 Akademik Takvim REKTÖRLÜK MAKAMI Öğrenci İşleri Daire Başkanlığına Fakültemize

Detaylı

FIRAT ÜNĠVERSĠTESĠ 2013-2014 EĞĠTĠM-ÖĞRETĠM YILI AKADEMĠK TAKVĠMĠ*

FIRAT ÜNĠVERSĠTESĠ 2013-2014 EĞĠTĠM-ÖĞRETĠM YILI AKADEMĠK TAKVĠMĠ* GÜZ YARIYILI *Enstitüler ve Tıp Fakültesi hariç FIRAT ÜNĠVERSĠTESĠ 2013-2014 EĞĠTĠM-ÖĞRETĠM YILI AKADEMĠK TAKVĠMĠ* 23Ağustos-23 Ekim 2013 :Fakülte/Yüksekokul/MYO dan Farabi değişim programıyla gelen 26Ağustos

Detaylı

T.C. DÜZCE ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ YATAY GEÇİŞ BAŞVURULARI TEMMUZ 2017

T.C. DÜZCE ÜNİVERSİTESİ TIP FAKÜLTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ YATAY GEÇİŞ BAŞVURULARI TEMMUZ 2017 T.C. DÜZCE ÜNİVERSİTESİ TIP FAKÜLTESİ 2017 2018 EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ YATAY GEÇİŞ BAŞVURULARI 24-28 TEMMUZ 2017 YENİ ÖĞRENCİ KAYITLARI ÖSYM tarafından İlan edilecektir DÖNEM I HÜCRE BİLİMLERİ

Detaylı

ÖNLİSANS VE LİSANS (DİŞ-HUKUK-TIP FAKÜLTELERİ HARİÇ)

ÖNLİSANS VE LİSANS (DİŞ-HUKUK-TIP FAKÜLTELERİ HARİÇ) GÜZ YARIYILI ANKARA ÜNİVERSİTESİ 2018- EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ ÖNLİSANS VE LİSANS (DİŞ-HUKUK-TIP FAKÜLTELERİ HARİÇ) DİŞ HEKİMLİĞİ FAKÜLTESİ HUKUK FAKÜLTESİ LİSANSÜSTÜ Yeni (ilk) Kayıt Başlama

Detaylı

İSTANBUL KEMERBURGAZ ÜNİVERSİTESİ 2014-2015 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİM

İSTANBUL KEMERBURGAZ ÜNİVERSİTESİ 2014-2015 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİM İSTANBUL KEMERBURGAZ ÜNİVERSİTESİ 2014-2015 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİM GÜZ DÖNEMİ 03 Mart 2014 Pazartesi Yabancı uyruklu öğrenci başvurularının alınmaya başlanması 05 Mayıs 2014 Pazartesi Lisansüstü

Detaylı

AKDENİZ ÜNİVERSİTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİM

AKDENİZ ÜNİVERSİTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİM AKDENİZ ÜNİVERSİTESİ 2017-2018 EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİM Ön Lisans ve Lisans Eğitim Öğretim Güz Yarıyılı Yeni Öğrencilerin Kesin Kayıtları ve Yeterlilik Sınavları Bahar Yarıyılı 11-16 Ağustos

Detaylı

T.C. MERSİN ÜNİVERSİTESİ Eğitim-Öğretim Yılı Akademik Takvimi

T.C. MERSİN ÜNİVERSİTESİ Eğitim-Öğretim Yılı Akademik Takvimi T.C. MERSİN ÜNİVERSİTESİ 2017-2018 Eğitim-Öğretim Yılı Akademik Takvimi Eğitim Öğretim Dönemi Başlangıç Bitiş 2017-2018 Eğitim-Öğretim Akademik Yılı 01.09.2017 30.08.2018 2017-2018 Eğitim Öğretim Akademik

Detaylı

BURSA TEKNİK ÜNİVERSİTESİ 2017 KAYIT VE BİLGİLENDİRME KILAVUZU

BURSA TEKNİK ÜNİVERSİTESİ 2017 KAYIT VE BİLGİLENDİRME KILAVUZU YABANCI DİL DERSLERİ MUAFİYET SINAVI Yabancı Dil Dersleri Muafiyet Sınavı, Bursa Teknik Üniversitesi 1.Sınıf öğrencilerinin sorumlu oldukları İngilizce derslerinden muaf olmalarına yönelik bir sınavdır.

Detaylı

T.C. ÜSKÜDAR ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ ODYOLOJİ BÖLÜMÜ MÜFREDAT PROGRAMI

T.C. ÜSKÜDAR ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ ODYOLOJİ BÖLÜMÜ MÜFREDAT PROGRAMI T.C. ÜSKÜDAR ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ ODYOLOJİ BÖLÜMÜ MÜFREDAT PROGRAMI BİRİNCİ SINIF I.DÖNEM (GÜZ) Kodu adı Teorik Uygulama Kredi AKTS ODY101 Anatomi 2 2 3 4 ODY103 Tıbbi Biyoloji ve Genetik

Detaylı

T.C. BEYKENT ÜNİVERSİTESİ EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ

T.C. BEYKENT ÜNİVERSİTESİ EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ T.C. BEYKENT ÜNİVERSİTESİ 2011-2012 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ GÜZ DÖNEMİ (LİSANS-ÖNLİSANS) 12 Ağustos 2011 Mali Kayıt Yenileme işlemlerinin son günü 05-09 Eylül 2011 Merkezi yerleştirme kesin

Detaylı

Bi ş kek, Kırgızistan

Bi ş kek, Kırgızistan Bişkek, Kırgızistan AKADEMİK TAKVİM LİSANS - ÖNLİSANS PROGRAMLARI AKADEMİK TAKVİM Güz Yarıyılı Faaliyet Bahar Yarıyılı 15-19 Temmuz 2013 Manas ÖSS ile Asıl Listeden Yerleşen Öğrencilerin Kayıtları 25-26

Detaylı

Ana-Çocuk Beslenmesi Ana-Çocuk Beslenmesi-UYGULAMA

Ana-Çocuk Beslenmesi Ana-Çocuk Beslenmesi-UYGULAMA BESLENME VE DİYETETİK BÖLÜMÜ 06.01.2014 Pazartesi 8-10 10:00 Beslenmeye Giriş 07.01.2014 Salı 8-9-10 09:00 İngilizce-I 08.01.2014 Çarşamba 8-9-10 09:00 Temel Matematik 8-9-10 10:00 Psikolojiye Giriş 09.01.2014

Detaylı

SAĞLIK KURUMLARI İŞLETMECİLİĞİ PROGRAMI-1.SINIF

SAĞLIK KURUMLARI İŞLETMECİLİĞİ PROGRAMI-1.SINIF BÜTÜNLEME LARI ÇİZELGESİ SAĞLIK KURUMLARI İŞLETMECİLİĞİ PROGRAMI-SINIF TARİH SAAT ADI 18 Ocak 2017 Çarşamba 11:00 Ticari Matematik Mehmet Aykaç B-101 B-102 B-103 18 Ocak 2017 Çarşamba 15:00 Temel Bilgi

Detaylı

YOZGAT BOZOK ÜNİVERSİTESİ FAKÜLTE/YÜKSEKOKUL/MESLEK YÜKSEKOKULU/ENSTİTÜLERİN EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ

YOZGAT BOZOK ÜNİVERSİTESİ FAKÜLTE/YÜKSEKOKUL/MESLEK YÜKSEKOKULU/ENSTİTÜLERİN EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ YOZGAT BOZOK ÜNİVERSİTESİ FAKÜLTE/YÜKSEKOKUL/MESLEK YÜKSEKOKULU/ENSTİTÜLERİN - EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ - GÜZ YARIYILI 18.06.-29.06. Yabancı Uyruklu Öğrencilerin Başvuruları (Lisans ve Önlisans)

Detaylı

T.C. MERSİN ÜNİVERSİTESİ Eğitim-Öğretim Yılı Akademik Takvimi

T.C. MERSİN ÜNİVERSİTESİ Eğitim-Öğretim Yılı Akademik Takvimi T.C. MERSİN ÜNİVERSİTESİ 2016-2017 Eğitim-Öğretim Yılı Akademik Takvimi Eğitim Öğretim Dönemi Başlangıç Bitiş 2016-2017 Eğitim-Öğretim Akademik Yılı 01.09.2016 30.08.2017 2016-2017 Eğitim Öğretim Akademik

Detaylı

AVRASYA ÜNİVERSİTESİ

AVRASYA ÜNİVERSİTESİ Dersin Adı Öğretim Dili Ortez ve Ortez Uygulamaları Türkçe Dersin Verildiği Düzey Ön Lisans (x) Lisans ( ) Yüksek Lisans( ) Doktora( ) Eğitim Öğretim Sistemi Örgün Öğretim ( X) Uzaktan Öğretim( ) Diğer

Detaylı

MYO BAŞKENT ÜNİVERSİTESİ

MYO BAŞKENT ÜNİVERSİTESİ BAŞKENT ÜNİVERSİTESİ Ko ny a Sa ğl ık Hi zm et le ri M YO 2 İçindekiler 05 Müdürün Mesajı 07 İlk ve Acil Yardım Programı 3 4 Müdürün Mesajı Bir ülkenin ekonomik, sosyal ve kültürel anlamdaki gelişimi,

Detaylı

T.C. ORDU ÜNİVERSİTESİ 2015-2016 EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ (ÖNLİSANS-LİSANS) (Tıp ve Diş Hekimliği Fakülteleri Hariç) GÜZ YARIYILI

T.C. ORDU ÜNİVERSİTESİ 2015-2016 EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ (ÖNLİSANS-LİSANS) (Tıp ve Diş Hekimliği Fakülteleri Hariç) GÜZ YARIYILI 2015-2016 EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ (ÖNLİSANS-LİSANS) (Tıp ve Diş Hekimliği Fakülteleri Hariç) 03-07 AĞUSTOS 2015 ÜNİVERSİTEMİZİ YENİ KAZANANLARIN KESİN KAYITLARININ YAPILMASI 31 AĞUSTOS-04

Detaylı

KARAR Tıp Fakültesi Dekanlığı nın tarih ve 1112 sayılı yazısı görüşüldü.

KARAR Tıp Fakültesi Dekanlığı nın tarih ve 1112 sayılı yazısı görüşüldü. T.C. GAZİOSMANPAŞA ÜNİVERSİTESİ SENATO KARARLARI KARAR TARİHİ OTURUM NO KARAR SAYISI Üniversitemiz Senatosu Rektör Prof. Dr. Mustafa ŞAHİN başkanlığında toplandı. KARAR 05.01- Koyulhisar Kaymakamlığı nın

Detaylı

Ders Kodu Yarıyıl T+U Saat Kredi AKTS Fizyoloji

Ders Kodu Yarıyıl T+U Saat Kredi AKTS Fizyoloji Ders Kodu Yarıyıl T+U Saat Kredi AKTS Fizyoloji 1 1 4 4 6 Ön Koşul Yok Dersin Dili Türkçe Dersin Seviyesi Lisans Dersin Türü Zorunlu Dersi Veren Öğretim Elemanı Dersin Yardımcıları Dersin Amacı Dersin

Detaylı

Manas ÖSS ile Üniversiteye Yerleştirilen Öğrencilerin Kayıtları BAHAR YARIYILI

Manas ÖSS ile Üniversiteye Yerleştirilen Öğrencilerin Kayıtları BAHAR YARIYILI YABANCI DİLLER YÜKSEKOKULU (ÖN LİSANS ve LİSANS HAZIRLIK SINIFLARININ ) GÜZ YARIYILI 16 Temmuz 2007 Pazartesi 20 Temmuz 2007 Cuma 01 Eylül 2007 Cumartesi Manas ÖSS ile Üniversiteye Yerleştirilen Öğrencilerin

Detaylı

AKADEMİK TAKVİM

AKADEMİK TAKVİM Mayıs 2017 05.05.2017-05.09.2017 Güz Yarıyılı Özel Öğrenci Başvurusu için Son Gün Temmuz 2017 01.07.2017-29.12.2017 Lisansüstü Güz Dönemi Doktora Yeterlik Sınavları Ağustos 2017 21.08.2017-18.09.2017 Güz

Detaylı

İSTANBUL RUMELİ ÜNİVERSİTESİ SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU RADYOTERAPİ PROGRAMI DERS İZLENCESİ

İSTANBUL RUMELİ ÜNİVERSİTESİ SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU RADYOTERAPİ PROGRAMI DERS İZLENCESİ İSTANBUL RUMELİ ÜNİVERSİTESİ SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU RADYOTERAPİ PROGRAMI DERS İZLENCESİ Kodu: YDL103 Adı: Yabancı Dil I Teorik + Uygulama: 2 + 0 AKTS: 4 Sınıf/Yarıyıl Ders Düzeyi Ders Türü

Detaylı

AKDENİZ ÜNİVERSİTESİ 2007/2008 Eğitim-Öğretim Yılı Akademik Takvim

AKDENİZ ÜNİVERSİTESİ 2007/2008 Eğitim-Öğretim Yılı Akademik Takvim BAŞVURU VE KAYIT KABUL AKDENİZ ÜNİVERSİTESİ 2007/2008 Eğitim-Öğretim Yılı Akademik Takvim A) YABANCI UYRUKLU ÖĞRENCİ BAŞVURU VE KAYITLARI 15 Haziran - 13 Temmuz 2007 Yabancı Uyruklu Öğrenci Başvuru Tarihleri

Detaylı

DERSİN ADI SINAV TARİHİ SINAV SAATİ SINAV SALONU

DERSİN ADI SINAV TARİHİ SINAV SAATİ SINAV SALONU BESLENME VE DİYETETİK BÖLÜMÜ ADI SINAV TARİHİ SINAV SAATİ SINAV SALONU SBES141 Psikoloji 10.11.2018 15:00 B219-B220 BES161 Temel Kimya I 12.11.2018 13:30 B219-B220 BES101 Mesleki Oryantasyon 13.11.2018

Detaylı

MCG Okul Öncesi Eğitime Giriş Dr. Öğr. Üyesi Ceyhun ERSAN Derslik 303

MCG Okul Öncesi Eğitime Giriş Dr. Öğr. Üyesi Ceyhun ERSAN Derslik 303 - 16:15 SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU ÇOCUK BAKIM VE GENÇLİK HİZMETLERİ BÖLÜMÜ ÇOCUK GELİŞİMİ PROGRAMI 2018-2019 AKADEMİK YILI GÜZ DÖNEMİ FİNAL SINAV PROGRAMI MCG 103 - Çocuk ve Oyun Dr. Öğr. Üyesi

Detaylı

EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ

EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ 2012-2013 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ»» Üniversitemizin Tıp Fakültesi, Diş Hekimliği, Sağlık Bilimleri Fakültesi, Yabancı Diller Yüksek Okulu haricindeki bütün birimlerinde Normal Öğretim ve İkinci

Detaylı

GÜZ DÖNEMİ BAHAR DÖNEMİ

GÜZ DÖNEMİ BAHAR DÖNEMİ 2017-2018 EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ ÖNLİSANS VE LİSANS PROGRAMLARI (Tıp ve Veteriner Fakülteleri ile Yabancı Diller Yüksekokulu Hariç) GÜZ DÖNEMİ 11-17 Eylül 2017 Ders kayıtları ve öğrenci katkı

Detaylı

NORMAL ÖĞRETİM DERS PROGRAMI

NORMAL ÖĞRETİM DERS PROGRAMI NORMAL ÖĞRETİM DERS PROGRAMI 1. Yarıyıl 1. Hafta ( 19.09.2011-23.09.2011 ) 08:30-09:20 : HEMŞİRELİĞE GİRİŞ ( Grup 1 ) Afyon Sağlık Y.O. - HEM-1 Ögr.Grv. YEŞİM CEYLANTEKİN Dersin takdimi 09:30-11:20 : BEDEN

Detaylı

I. SINIF. Konuşma Sanatı ve Diksiyon. Mikrobiyoloji-Parazitoloji. Histoloji-Embriyoloji. İngilizce II Okutman. Ebelikte Temel Uygulamalar

I. SINIF. Konuşma Sanatı ve Diksiyon. Mikrobiyoloji-Parazitoloji. Histoloji-Embriyoloji. İngilizce II Okutman. Ebelikte Temel Uygulamalar BESLENME VE DİYETETİK BÖLÜMÜ 2012-2013 EĞİTİM - ÖĞRETİM YILI BAHAR YARIYILI BİTİRME SINAVLARI 10.06.2013 Pazartesi 8 10.00 Atatürk İlkeleri ve İnkılap Tarihi II 11.06.2013 Salı 8 11.00 Psikoloji ve Davranış

Detaylı

DOĞU AKDENİZ ÜNİVERSİTESİ

DOĞU AKDENİZ ÜNİVERSİTESİ DOĞU AKDENİZ ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ 1. IYAB101 Acil Hasta Bakımı - I SAĞLIK HİZMETLERİ YÜKSEKOKULU İLK VE ACİL YARDIM PROGRAMI DERS İÇERİKLERİ Bu dersin amacı, hastane öncesi acil bakım;

Detaylı

Mersin Üniversitesi Senatosunun 27/09/2018 Tarihli ve 2018/136 Sayılı Kararının Eki.

Mersin Üniversitesi Senatosunun 27/09/2018 Tarihli ve 2018/136 Sayılı Kararının Eki. T.C. MERSİN ÜNİVERSİTESİ 2018-2019 Eğitim-Öğretim Yılı Akademik Takvimi Eğitim Öğretim Dönemi Başlangıç Bitiş 2018-2019 Eğitim-Öğretim Akademik Yılı 03.09.2018 29.08.2019 2018-2019 Eğitim Öğretim Akademik

Detaylı

Tarsus Üniversitesi Senatosunun 22/06/2018 Tarihli ve 2018/1 Sayılı Kararının Eki.

Tarsus Üniversitesi Senatosunun 22/06/2018 Tarihli ve 2018/1 Sayılı Kararının Eki. T.C. TARSUS ÜNİVERSİTESİ 2018-2019 Eğitim-Öğretim Yılı Akademik Takvimi Eğitim Öğretim Dönemi Başlangıç Bitiş 2018-2019 Eğitim-Öğretim Akademik Yılı 03.09.2018 29.08.2019 2018-2019 Eğitim Öğretim Akademik

Detaylı

2.YIL/ 2.yarıyıl Bahar

2.YIL/ 2.yarıyıl Bahar MANİPULATİF TEDAVİ TEKNİKLERİ 2 Dersin Adı Kodu Yarıyıl Teori Laboratuar AKTS Manipulatif teknikleri 2 tedavi FTR 208 2.YIL/ 2.yarıyıl Bahar (saat/hafta) (saat/hafta) (saat/hafta) 2 3-3 Önkoşullar Yok

Detaylı

SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU GÜZ YARIYILI FİNAL SINAVI TARİHLERİ. AĞIZ ve DİŞ SAĞLIĞI SINAV TARİHİ

SAĞLIK HİZMETLERİ MESLEK YÜKSEKOKULU GÜZ YARIYILI FİNAL SINAVI TARİHLERİ. AĞIZ ve DİŞ SAĞLIĞI SINAV TARİHİ FİNAL I TARİHLERİ AĞIZ ve DİŞ SAĞLIĞI YERİ FARMAKOLOJİ 05.01.2015 13:00 104 TÜRK DİLİ I 06.01.2015 10:00 301 ALET BAKIMI, KORUMASI VE ST. YÖN. 06.01.2015 13:00 104 DİŞ MORFOLOJİSİ 07.01.2015 13:00 104

Detaylı

GÜZ DÖNEMİ BAHAR DÖNEMİ

GÜZ DÖNEMİ BAHAR DÖNEMİ ÖNLİSANS VE LİSANS PROGRAMLARI (Tıp ve Veteriner Fakülteleri ile Yabancı Diller Yüksekokulu Hariç) 03-07 Ağustos 2015 ÖSYM tarafından önlisans ve lisans programlarına yerleştirilen öğrencilerin kayıtları

Detaylı

TARİHLİ EĞİTİM KOMİSYONU KARARLARI

TARİHLİ EĞİTİM KOMİSYONU KARARLARI 31.07.2012 TARİHLİ EĞİTİM KOMİSYONU KARARLARI Eğitim Komisyon Karar No: 195 Sağlık Bilimleri Fakültesi nin Ergoterapi Bölümü nün Bologna süreci kapsamında eğitimöğretim programlarının düzenlemesi hakkındaki

Detaylı

ÇANAKKALE ONSEKİZ MART ÜNİVERSİTESİ TIP FAKÜLTESİ Eğitim Yılı Dönem V Fiziksel Tıp ve Rehabilitasyon Stajı Eğitim Programı

ÇANAKKALE ONSEKİZ MART ÜNİVERSİTESİ TIP FAKÜLTESİ Eğitim Yılı Dönem V Fiziksel Tıp ve Rehabilitasyon Stajı Eğitim Programı ÇANAKKALE ONSEKİZ MART ÜNİVERSİTESİ TIP FAKÜLTESİ 2017-2018 Eğitim Yılı Dönem V Fiziksel Tıp ve Rehabilitasyon Stajı Eğitim Programı GENEL BİLGİLER: Staj Eğitim Sorumlusu Staj süresi AKTS kredisi : Yrd.

Detaylı

Prof.Dr. Mustafa ARSLAN Müdür

Prof.Dr. Mustafa ARSLAN Müdür 2013-2014 ÖĞRETİM YILI BAHAR YARIYILI ÇOCUK GELİŞİMİ PROGRAMI I.SINIF I VE II. ÖĞRETİM -VİZE SINAV PROGRAMI 21/04/2014 10:00 ÇGP I.Ö ÇGP II.Ö ÇOCUK EDEBİYATI Yrd.Doç.Dr.. Belgin UZUN Konf. S.-140-144 21/04/2014

Detaylı

GÜZ DÖNEMİ. Kurumiçi Yatay Geçiş Başvuruları *Merkezi Yerleştirme Puanına Göre/Akademik Başarıya Göre Üniversiteye YENİ KAYIT

GÜZ DÖNEMİ. Kurumiçi Yatay Geçiş Başvuruları *Merkezi Yerleştirme Puanına Göre/Akademik Başarıya Göre Üniversiteye YENİ KAYIT TARİHLER 2024 Temmuz 0307 Ağustos *ÖSYS ile yerleşen GÜZ DÖNEMİ 1 ÖĞRETİM YILI Çift Anadal ve Yandal Programları Başvuruları *ÖSYS ile yerleşen 10 Ağustos Yurtdışı Kontenjanlar Başvuruları için SON Yurtdışı

Detaylı

1.YIL/ 2.yarıyıl Bahar

1.YIL/ 2.yarıyıl Bahar ISI-IŞIK VE HİDROTERAPİ Dersin Adı Kodu Yarıyıl Teori Laboratuar AKTS Isı-Işık ve Hidroterapi FTR 1.YIL/ 2.yarıyıl Bahar 134 Önkoşullar Yok Dersin dili Türkçe Dersin Türü Seçmeli Dersin öğrenme ve Teorik

Detaylı

SINIF BAHAR YARIYILI D.KODU DERSİN ADI

SINIF BAHAR YARIYILI D.KODU DERSİN ADI DİŞÇİLİK HİZMETLERİ BÖLÜMÜ AĞIZ VE DİŞ SAĞLIĞI PROGRAMI I. SINIF BAHAR YARIYILI SH-112 Farmakoloji 2-2 Z 2 SH-124 Fizyoloji 2-2 Z 2 DS-142 Alet Bakımı ve Koruması 1 2 3 M 2 DS-146 DS-148 Temel Ortodonti

Detaylı

ÖNLİSANS VE LİSANS (TIP-DİŞ -HUKUK FAKÜLTELERİ HARİÇ)

ÖNLİSANS VE LİSANS (TIP-DİŞ -HUKUK FAKÜLTELERİ HARİÇ) BAHAR YARIYILI ANKARA ÜNİVERSİTESİ 2017- EĞİTİM-ÖĞRETİM YILI AKADEMİK TAKVİMİ Yeni (ilk) Kayıt Başlama ve Bitiş Tarihleri ÖNLİSANS VE LİSANS (TIP-DİŞ -HUKUK FAKÜLTELERİ HARİÇ) DİŞ HEKİMLİĞİ FAKÜLTESİ HUKUK

Detaylı

T.C. ORDU ÜNİVERSİTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ (ÖNLİSANS-LİSANS) (Tıp ve Diş Hekimliği Fakülteleri Hariç) GÜZ YARIYILI

T.C. ORDU ÜNİVERSİTESİ EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ (ÖNLİSANS-LİSANS) (Tıp ve Diş Hekimliği Fakülteleri Hariç) GÜZ YARIYILI 2016- EĞİTİM ÖĞRETİM YILI AKADEMİK TAKVİMİ (ÖNLİSANS-LİSANS) (Tıp ve Diş Hekimliği Fakülteleri Hariç) 12-16 AĞUSTOS 2016 ÜNİVERSİTEMİZİ YENİ KAZANANLARIN ELEKTRONİK KAYIT TARİHLERİ 15-19 AĞUSTOS 2016 ÜNİVERSİTEMİZİ

Detaylı

Yeni ders açma önerilerinin, Enstitü/Fakülte/Yüksekokul/MYO kurullarında değerlendirilmesi, kabul edilen önerilerin sistem onaylarının verilmesi.

Yeni ders açma önerilerinin, Enstitü/Fakülte/Yüksekokul/MYO kurullarında değerlendirilmesi, kabul edilen önerilerin sistem onaylarının verilmesi. T.C. - - - - 1. Aşama (Ders Teklif ve Onay İşlemleri) 09-29 Mayıs 30-31 Mayıs 01-03 Haziran 06-10 Haziran Yeni ders açma önerilerinin öğretim elemanları tarafından sisteme girilmesi (havuza ders atılması).

Detaylı

T.C. İNÖNÜ ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ SINAV VE DERS UYGULAMA ESASLARI BİRİNCİ BÖLÜM. Amaç, Kapsam, Yasal Dayanak ve Tanımlar

T.C. İNÖNÜ ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ SINAV VE DERS UYGULAMA ESASLARI BİRİNCİ BÖLÜM. Amaç, Kapsam, Yasal Dayanak ve Tanımlar T.C. İNÖNÜ ÜNİVERSİTESİ SAĞLIK BİLİMLERİ FAKÜLTESİ SINAV VE DERS UYGULAMA ESASLARI BİRİNCİ BÖLÜM Amaç, Kapsam, Yasal Dayanak ve Tanımlar Amaç MADDE 1-Bu Yönergenin amacı İnönü Üniversitesi Ön Lisans ve

Detaylı

BURSA ORHANGAZİ ÜNİVERSİTESİ Eğitim - Öğretim Yılı Akademik Takvimi

BURSA ORHANGAZİ ÜNİVERSİTESİ Eğitim - Öğretim Yılı Akademik Takvimi BURSA ORHANGAZİ ÜNİVERSİTESİ 2015-2016 Eğitim - Öğretim Yılı Akademik Takvimi GÜZ YARIYILI 18 Mayıs 2015 Pazartesi-28 Ağustos 2015 Cuma Uluslararası Öğrencilerin Başvuru Alımları 15 Haziran 2015 Pazartesi-31

Detaylı

SINAVDA DİKKAT EDİLECEK HUSUSLAR

SINAVDA DİKKAT EDİLECEK HUSUSLAR SINAVDA DİKKAT EDİLECEK HUSUSLAR 1- Sınav salonlarında görevli öğretim elemanları tarafından mutlaka öğrenci kimlik kartlarının kontrolleri yapılacaktır. Öğrenci Kimlik Kartı yanında olmayan öğrenciler

Detaylı