ZOOTEKNİ ANABİLİM DALI

Save this PDF as:
 WORD  PNG  TXT  JPG

Ebat: px
Şu sayfadan göstermeyi başlat:

Download "ZOOTEKNİ ANABİLİM DALI"

Transkript

1 ÇUKUROVA ÜNİVERSİTESİ FEN BİLİMLERİ ENSTİTÜSÜ DOKTORA TEZİ Bahri Devrim ÖZCAN SICAKLIĞA DİRENÇLİ AMİLAZ GENLERİNİN KLONLANMASI ÜZERİNE ÇALIŞMALAR ZOOTEKNİ ANABİLİM DALI ADANA, 2005

2 ÇUKUROVA ÜNİVERSİTESİ FEN BİLİMLERİ ENSTİTÜSÜ SICAKLIĞA DİRENÇLİ AMİLAZ GENLERİNİN KLONLANMASI ÜZERİNE ÇALIŞMALAR Bahri Devrim ÖZCAN DOKTORA TEZİ ZOOTEKNİ ANABİLİM DALI Bu Tez.../.../2005 Tarihinde Aşağıdaki Jüri Üyeleri Tarafından Oybirliği/Oyçokluğu İle Kabul Edilmiştir. İmza... İmza.... İmza... Prof.Dr. Numan ÖZCAN Prof.Dr. H. Rüştü KUTLU Prof.Dr. Halil KASAP DANIŞMAN ÜYE ÜYE İmza Prof.Dr. Mehmet TOPAKTAŞ ÜYE İmza.... Doç.Dr. Mehmet Sait EKİNCİ ÜYE Bu tez Enstitümüz Zootekni Anabilim Dalında hazırlanmıştır. Kod No: Prof. Dr. Aziz ERTUNÇ Enstitü Müdürü Bu Çalışma Ç.Ü. Bilimsel Araştırma Projeleri Birimi Tarafından Desteklenmiştir. Proje No: FBE2002D104 Not: Bu tezde kullanılan özgün ve başka kaynaktan yapılan bildirişlerin, çizelge, şekil ve fotoğrafların kaynak gösterilmeden kullanımı, 5846 sayılı Fikir ve Sanat Eserleri Kanunundaki hükümlere tabidir.

3 ÖZ DOKTORA TEZİ SICAKLIĞA DİRENÇLİ AMİLAZ GENLERİNİN KLONLANMASI ÜZERİNE ÇALIŞMALAR Bahri Devrim ÖZCAN ÇUKUROVA ÜNİVERSİTESİ FEN BİLİMLERİ ENSTİTÜSÜ ZOOTEKNİ ANABİLİM DALI Danışman : Prof.Dr. Numan ÖZCAN Yıl: 2005, Sayfa: 122 Jüri : Prof.Dr. Numan ÖZCAN Prof.Dr. Hasan Rüştü KUTLU Prof.Dr. Halil KASAP Prof.Dr. Mehmet TOPAKTAŞ Doç.Dr. Mehmet Sait EKİNCİ Yapılan bu çalışma ile Bacillus stearothermophilus a ait sıcaklığa dirençli α-amilaz genini taşıyan pc194α rekombinant vektörü, Bacillus subtilis YB886 ve Bacillus subtilis BR151 suşlarına elektroporasyon tekniği ile aktarılmıştır. α-amilaz enziminin konakçıda hücre dışına salındığı gerek nişasta içeren LB/Agar besiyerlerinde, gerekse SDS-Nişasta-PAGE de zymogram analizleri ile gösterilmiştir. Ayrıca rekombinant bakterilerden izole edilen rekombinant plazmidlerin Hind III enzimi ile kesimi sonucu agaroz jelde 5.25 kbç lik sıcaklığa dirençli α-amilaz genini taşıyan DNA bandı ile 2.9 kbç lik pc194 bandı gözlenmiştir. Rekombinant B. subtilis suşlarına ait hücre dışı sıvılarının 80 ºC de 15 dakika inkübasyonu ile B. subtilis kökenli mezofilik proteinler denatüre edilirken, sıcaklığa dirençli α-amilaz enziminden sorumlu bant SDS-PAGE ve SDS-Nişasta- PAGE de gösterilmiştir. Diğer taraftan sıcaklığa dirençli β-amilaz geni Thermoanaerobacterium thermosulfurogenes DNA sından PCR tekniği ile izole edilerek pbluescript II KS/SK, pl2 ve pnw33n klonlama vektörleri ile Escherichia coli de, pub110 klonlama vektörü ile de Bacillus subtilis BR151 ve Bacillus amyloliquefaciens bakterilerinde klonlanmıştır. Rekombinant bakterilerden izole edilen plazmidlerin Bam HI enzimi ile kesilip β- amilaz genine ait kbç lik DNA parçasının agaroz jelde gösterilmesiyle gen entegrasyonunun tamamlandığı anlaşılmıştır. LB/Nişasta/Agar plaklarına ekilen rekombinant Escherichia coli kolonilerinin I 2 boyaması sonucu pozitif zon vermesi ile üretilen proteinin aktif olduğu tespit edilmiştir. Ayrıca rekombinant vektörler kalıp olarak kullanılmış ve sıcaklığa dirençli β-amilaz geni PCR ile çoğaltılarak elde edilen ürün agaroz jelde gösterilmiştir. Buna ilaveten, elde edilen PCR ürününün Hind III enzimi ile kesilmesi sonucu elde edilen yaklaşık 1.5 ve 0.5 kbç lik fragmentlerin agaroz jel elektroforezde gösterilmesi genin klonlanmasına yönelik bulguları da desteklemiştir. Fakat sıcaklığa dirençli β-amilaz geni B. subtilis BR151 ve B. amyloliquefaciens de klonlanmasına karşın LB/Nişasta/Agar plaklarında enzim aktivitesi görülmemiştir. Buna karşılık hücre dışı enzimlerin denatüre edilerek SDS-Nişasta-PAGE de elektroforezi ve arkasından tekrar renatüre edilerek ortamdaki substratı parçalaması sonucu zymogram analizinde enzimatik aktivite görülmüştür. Anahtar Kelimeler: Bacillus stearothermophilus, Thermoanaerobacterium thermosulfurogenes, α-amilaz, β- amilaz, Klonlama I

4 ABSTRACT PhD THESIS STUDIES ON CLONING OF THERMOSTABLE AMYLASE GENES Bahri Devrim ÖZCAN DEPARTMENT OF ANIMAL SCIENCE INSTITUTE OF NATURAL AND APPLIED SCIENCES UNIVERSITY OF ÇUKUROVA Supervisor : Prof.Dr. Numan ÖZCAN Year: 2005, Pages: 122 Jury : Prof.Dr. Numan ÖZCAN Prof.Dr. Hasan Rüştü KUTLU Prof.Dr. Halil KASAP Prof.Dr. Mehmet TOPAKTAŞ Doç.Dr. Mehmet Sait EKİNCİ In this study, the recombinant pc194α vector carrying thermostable α-amylase gene from Bacillus stearothermophilus was transformed into Bacillus subtilis YB886 and Bacillus subtilis BR151 by electroporation technique. It was showed on LB/Agar plates and zymogram analyses on SDS-Starch-PAGE that recombinant strains synthesized thermostable α-amylase extracellularly. Hind III digestion of recombinant plasmids yielded 5.25 kbp fragment of DNA carrying the gene encoding thermostable α-amylase and 2.9 kbp fragment of pc194 vector on agarose gel electrophoresis. Furthermore, extracellular proteins of recombinant strains were treated a temperature of 80 ºC for 15 minutes and thus mesophilic proteins origined from Bacillus subtilis were denaturated and thermostable α-amylase enzyme showed on both SDS-PAGE and SDS-Starch-PAGE. On the other hand thermostable β-amylase gene from Thermoanaerobacterium thermosulfurogenes was cloned in Escherichia coli using pbluescript II KS/SK, pl2 and pnw33n, in Bacillus subtilis BR151 and Bacillus amyloliquefaciens using pub110 by PCR technique. Digestion of plasmids isolated from recombinant strains by Bam HI was showed the kbp β-amylase gene band following agarose gel electrophoresis. On LB/Starch/Agar plates, all recombinant Escherichia coli colonies showed positive zones with I 2 staining. Thermostable β-amylase gene was isolated from recombinant plasmids by PCR and visualized by agarose gel electrophoresis. In addition, 1.5 ve 0.5 kbp fragments produced by digestion of PCR products with Hind III visualized by agarose gel electrophoresis supported the results. Although the thermostable β-amylase cloned in B. subtilis BR151 and B. amyloliquefaciens, these microorganisms didn t show enzymatic activity on LB/Starch/Agar plates. But after denaturing and electrophoresis of extracellular proteins on SDS-Starch-PAGE and hydrolysis of substrat by renaturated protein, enzymatic activity have been seen by zymogram analysis. Key Words: Bacillus stearothermophilus, Thermoanaerobacterium thermosulfurogenes, α-amylase, β-amylase, Cloning II

5 TEŞEKKÜR Öncelikle bu tez çalışmasında bana büyük emeği geçen, beni her konuda yönlendiren ve hiçbir yardımı esirgemeyen danışman hocam sayın Prof.Dr. Numan ÖZCAN a sonsuz teşekkürlerimi bir borç bilirim. Ayrıca laboratuar çalışmalarımdaki katkılarından ve manevi desteklerinden dolayı değerli arkadaşlarım Ar.Gör. Dr. Adem ALTINALAN, Ar.Gör. Meltem AŞAN, Ar.Gör. Makbule BAYLAN, Yüksek Lisans öğrencileri Cihan BAKLACI, Müge SAYICI ya ve diğer mesai ve öğrenci arkadaşlarıma çok teşekkür ederim. Laboratuar çalışmaları sırasında beni yönlendiren ve jel görüntülerinin alınması sırasında değerli yardımlarını esirgemeyen Ç.Ü. Tıp Fakültesi Tıbbi Biyoloji ABD Öğretim Üyesi sayın Prof.Dr. Halil KASAP ve Ar.Gör. Ali İrfan GÜZEL e, anaerobik çalışmalar konusunda değerli desteklerini esirgemeyen Ç.Ü. Tıp Fakültesi Mikrobiyoloji ABD Öğretim Üyesi sayın Prof.Dr. Fatih KÖKSAL ve yardımcı elemanlarına da teşekkürü bir borç bilirim. Tez İzleme Komitesi nde bulunduğu süre içerisinde beni yönlendiren sayın Prof.Dr. Osman KAFTANOĞLU hocama sonsuz teşekkürlerimi sunarım. Bu tez çalışmasını ilgili projelerle maddi yönden destekleyen Ç.Ü. Bilimsel Araştırma Projeleri Birimi ile DPT ye de ayrıca teşekkür ederim. Her türlü maddi ve manevi yardımlarını benden esirgemeyen eşim Yelda ÖZCAN, oğlum Şevki Ertuğrul ÖZCAN ve ailemin diğer fertlerine de sonsuz teşekkürlerimi sunarım. III

6 İÇİNDEKİLER SAYFA ÖZ...I ABSTRACT... II TEŞEKKÜR...III İÇİNDEKİLER...IV ÇİZELGELER DİZİNİ... X ŞEKİLLER DİZİNİ...XI SİMGELER VE KISALTMALAR...XIV 1. GİRİŞ Endüstriyel Enzimlerin Üretim Kaynakları Termofiller ve Sıcaklığa Dirençlilik Nişastanın Enzimatik Hidrolizi Sıcaklığa Dirençli α-amilazın Nişasta Sanayinde Kullanımı α-amilaz Enziminin Hayvan Beslemede Kullanımı Sıcaklığa Dirençli α-amilazın Yem Sektöründeki Önemi β-amilaz Enziminin Endüstriyel Kullanımı Araştırmanın Amacı Araştırmanın Kapsamı ÖNCEKİ ÇALIŞMALAR Sıcaklığa Dirençli α-amilaz Genine İlişkin Önceki Çalışmalar Sıcaklığa Dirençli β-amilaz Genine İlişkin Önceki Çalışmalar MATERYAL VE METOD Materyal Bakteri, Plazmid ve Büyüme Ortamları Kimyasallar Aletler Metod Bakterilerde α-amilaz Aktivitesinin Belirlenmesi Bakterilerde CMCaz, Ksilanaz ve Likenaz Aktivitelerinin Belirlenmesi Sıcaklığa Dirençli α-amilaz Geninin B. subtilis Suşlarına Elektroporasyon Tekniği ile Aktarılması B.subtilis ATCC31786/pC194α Bakterisinden pc194α Rekombinant IV

7 Vektörünün İzolasyonu DNA nın RNaz Enzimi ile RNA dan Arındırılması pc194α Rekombinant Vektörün B. subtilis YB886 ve B. subtilis BR151 Suşlarına Elektroporasyon Tekniği ile Aktarılması Transformasyon Plaklarından Rekombinant B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Kolonilerinin Seçimi ve Fenotipik Testleri B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilerin Antibiyotik İçermeyen ve İçeren Besiyerlerinde Koloni Gelişimi Yönünden Karşılaştırılması B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilerin α-amilaz Aktivitesi Bakımından Karşılaştırılması B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilerin CMCaz, Ksilanaz ve Likenaz Aktiviteleri Bakımından Karşılaştırılması B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α dan İzole Edilen Rekombinant pc194α Plazmidlerinin Kesim Analizi B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilere Ait Hücredışı Proteinlerin SDS-PAGE ve Zymogram Analizleri (1). SDS-PAGE nin Hazırlanması (2). Hücredışı Proteinlerin TCA Muamelesi İle Elde Edilmesi (3). Elektroforez Aletinin Çalıştırılması (4). B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilere Ait Toplam Proteinlerin SDS-PAGE de Karşılaştırılması (5). B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilerin SDS-Nişasta-PAGE de Karşılaştırılması...37 V

8 (6). Sıcaklığa Dirençli α-amilaz Enziminden Sorumlu Bandın SDS-Nişasta-PAGE de Gösterilmesi (7). Sıcaklık Uygulaması ile Mezofilik Kökenli Proteinlerin Denatüre Edilerek Sıcaklığa Dirençli α-amilazın SDS-PAGE ve SDS-Nişasta-PAGE de Gösterilmesi Sıcaklığa Dirençli β-amilaz Geninin Değişik Bakterilerde Klonlanması Sıcaklığa Dirençli β-amilaz Geninin PCR ile Amplifikasyonu (1). β-amilaz Geninin Amplifikasyonu İçin Primer Dizaynı (2). T. thermosulfurogenes den Kromozomal DNA İzole Edilerek RNA dan Arındırılması (3). Programlama (4). Reaksiyonun Hazırlanması (5). PCR Ürününün Elektroforezi ve Agaroz Jelden Arıtılması Sıcaklığa Dirençli β-amilaz Geninin pbluescript II KS/SK Klonlama Vektörü ile E. coli de Klonlanması (1). pbluescript II KS/SK Klonlama Vektörünün İzolasyonu ve Ligasyona Hazırlanması (2). pbluescript II KS/SK Klonlama Vektörünün Sma I Endonüklazı ile Kesimi (3). Sıcaklığa Dirençli β-amilaz Geni ile pbluescript II KS/SK DNA sının Ligasyonu (4). Kompetent Bakteri Hazırlama ve Transformasyon (5). β-amilaz Geni Taşıyan Rekombinant Bakterilerin Belirlenmesi (6). β-amilaz Pozitif Kolonilerden İzole Edilen Rekombinant Vektörlerin İnsört ve PCR Analizleri Sıcaklığa Dirençli β-amilaz Geninin pub110 Klonlama Vektörü ile B. subtilis BR151 ve B. amyloliquefaciens de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geninin pub110 a Ligasyonu (2). pub110β Rekombinant Vektörün B. subtilis BR151 VI

9 Bakterisine Elektrotransformasyonu (3). pub110β Rekombinant Vektörün B. amyloliquefaciens Bakterisine Elektrotransformasyonu (4). Koloni Seçimi ve Rekombinantların Karakterizasyonu (5). B. subtilis BR151/pUB110β ve B. amyloliquefaciens/pub110β ya İlişkin Plak Testleri (6). Rekombinant pub110β ya İlişkin Kesim ve PCR Analizleri (7). Sıcaklık Uygulaması ile Mezofilik Kökenli Proteinlerin Denatüre Edilerek Sıcaklığa Dirençli β-amilazın SDS-Nişasta-PAGE de Gösterilmesi Sıcaklığa Dirençli β-amilaz Geninin pl2 Klonlama Vektörü ile E. coli de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geni ile pl2 Vektörünün Ligasyonu (2). β-amilaz Geni Taşıyan Rekombinant Plazmidin (pbt10β) E. coli XL1 Blue MRF' Bakterisine Transferi (3). Rekombinant E. coli Kolonilerinin Seçimi ve Karakterizasyonu (4). pbt10β dan β-amilaz Geninin PCR ile Sentezlenmesi Sıcaklığa Dirençli β-amilaz Geninin pnw33n Klonlama Vektörü ile E. coli de Klonlanması (1). β-amilaz Geninin pnw33n Vektörü ile Ligasyona Hazırlanması (2). pnw33n Vektörü ile β-amilaz Geninin Ligasyonu (3). β-amilaz Geni Taşıyan Rekombinant pnw33nβ Vektörünün E. coli XL1 Blue MRF' Bakterisine Transferi (4). Koloni Seçimi ve Rekombinantların Karakterizasyonu (5). β-amilaz Pozitif Koloniden İzole Edilen Rekombinant Vektörün İnsört ve PCR Analizleri Sıcaklığa Dirençli β-amilaz Geni Taşıyan Rekombinant Bakterilere İlişkin SDS-PAGE ve Zymogram Analizleri...57 VII

10 (1). Bakterilerden Proteinlerin İzolasyonu (2). Bakterilere Ait Toplam Proteinlerin SDS-PAGE de Karşılaştırılması (3). Bakteriyel Proteinlerin SDS-Nişasta-PAGE de Karşılaştırılması BULGULAR VE TARTIŞMA Bulgular Sıcaklığa Dirençli α-amilaz Geninin Klonlanmasına Yönelik Bulgular Sıcaklığa Dirençli α-amilaz Geninin B. subtilis Suşlarına Elektroporasyon Tekniği ile Aktarılması (1) Rekombinant Kolonilerin Selektif Besiyerlerinde Fenotipik Testleri (2). B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α dan Rekombinant pc194α Vektörünün İzole Edilerek Kesim Analizi (3). Rekombinant ve Orijinal Bakterilere Ait Toplam Proteinlerin SDS-PAGE de Karşılaştırılması (4). Rekombinant ve Orijinal Bakterilere Ait Toplam Proteinlerin SDS-Nişasta-PAGE de Karşılaştırılması (5). Sıcaklık Uygulaması ile Mezofilik Kökenli Proteinlerin Denatüre Edilerek Sıcaklığa Dirençli α-amilazın SDS-Nişasta-PAGE de Gösterilmesi Sıcaklığa Dirençli β-amilaz Geninin Klonlanmasına Yönelik Bulgular Sıcaklığa Dirençli β-amilaz Geninin E. coli de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geninin PCR ile Amplifikasyonu (2). Sıcaklığa Dirençli β-amilaz Geninin pbluescript II KS/SK Vektörüne Ligasyonu (3). pbluescript II KS/SK + β-amilaz (pbluescriptβ) Vektörü Taşıyan Rekombinant E. coli Kolonilerinin Tespiti (4). E. coli/pbluescriptβ Kolonilerinden pbluescriptβ Plazmidinin İzolasyonu, İnsört ve PCR Analizi...68 VIII

11 β-amilaz Geninin B. subtilis BR151 ve B. amyloliquefaciens de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geni ile pub110 Vektörünün Ligasyonu (2). pub110β Taşıyan B. subtilis BR151/pUB110β ve B. amyloliquefaciens/pub110β Rekombinantlarının Tespiti (3). Rekombinant pub110β ya İlişkin İnsört ve PCR Analizleri Sıcaklığa Dirençli β-amilaz Geninin Laktik Asit Bakterilerinde Klonlanması Çalışmaları (1). pbt10β Rekombinant Vektörünün Oluşturulması ve Ara Konakçı E. coli ye Transferi (2). Rekombinant E. coli Kolonilerinin Seçimi ve Karakterizasyonu (3). β-amilaz Geninin pbt10β Vektöründen PCR ile Sentezlenmesi Sıcaklığa Dirençli β-amilaz Geninin pnw33n Vektörüne Takılarak Yeniden B. subtilis de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geni ile pnw33n Vektörünün Ligasyonu ve Ara Konakçı E. coli XL1 Blue MRF' Bakterisine Transferi (2). pnw33nβ Taşıyan Rekombinant E. coli Kolonilerinin Tespiti (3). pnw33nβ Vektörünün İnsört ve PCR Analizi Bakterilere Ait Toplam Proteinlerin SDS-PAGE de Karşılaştırılması Tartışma SONUÇLAR VE ÖNERİLER...85 KAYNAKLAR...88 ÖZGEÇMİŞ...99 EKLER EK-1. SOLÜSYONLAR EK-2. PROTOKOLLER IX

12 ÇİZELGELER DİZİNİ SAYFA Çizelge 1.1. Bazı önemli termofilik ve hipertermofilik enzimlerin kaynakları ve endüstriyel uygulamaları...4 Çizelge yılında Dünya genelinde üretilen karma yemin hayvan gruplarına göre dağılımı...8 Çizelge 3.1. Sıcaklığa dirençli β-amilaz geninin baz dizilimi ve kodladığı proteinin amino asit dizini...40 Çizelge 3.2. β-amilaz geninin T. thermosulfurogenes DNA sından amlifikasyonu için PCR cihazına uygulanan program...43 Çizelge 3.3. Sıcaklığa dirençli β-amilaz geninin amplifikasyonu için hazırlanan PCR reaksiyonu bileşenleri...43 Çizelge 3.4. pbluescript II KS/SK vektörünün Sma I endonükleazı ile kesim reaksiyonu bileşenleri...45 Çizelge 3.5. Sıcaklığa dirençli β-amilaz geni ile pbluescript II KS/SK vektörü için hazırlanan ligasyon reaksiyonu bileşenleri...46 Çizelge 3.6. β-amilaz geni ile pub110 vektörünün ligasyon reaksiyonu bileşenleri...49 Çizelge 3.7. β-amilaz geni ile pbt10 vektörünün ligasyon reaksiyonu bileşenleri 52 Çizelge 3.8. pnw33n vektörünün Bam HI enzimi ile kesim reaksiyonu bileşenleri...54 Çizelge 3.9. pnw33n vektörünün alkalin fosfataz reaksiyonu bileşenleri...55 Çizelge β-amilaz geni ile pnw33n vektörünün ligasyon reaksiyonu bileşenleri...55 X

13 ŞEKİLLER DİZİNİ SAYFA Şekil 1.1. Nişastanın amiloz ve amilopektin formları...6 Şekil 1.2. Nişastanın hidrolizi ile glukoz, fruktoz ve maltoz üretimi...8 Şekil 3.1. Bakterilerin LB sıvı besiyerinde üretilmeleri...30 Şekil 3.2. CMCaz, ksilanaz ve likenaz pozitif/negatif suşların Congo-red boyaması ile belirlenmesi...31 Şekil 3.3. α-amilaz +, CMCaz +, ksilanaz + ve likenaz + B. subtilis kolonileri gelişmiş LB/agar plakları...32 Şekil 3.4. Mielenz ve Mickel (1985) tarafından geliştirilmiş pc194α vektörü...33 Şekil 3.5. B. subtilis ATCC 31786/pC194α bakterisinin farklı substratlar içeren LB/Agar plaklarında fenotipik testi...33 Şekil 3.6. Denatüre proteinlerin elektroforez işlemine tabi tutulması...37 Şekil 3.7. β-amilaz genini T. thermosulfurogenes genomundan kopyalayacak primer dizileri...39 Şekil 3.8. β-amilaz geninin pbluescript II KS/SK vektörüne ligasyonunun şematik modeli...46 Şekil 3.9. pub110β nın oluşturulmasının şematik modeli...49 Şekil pl2 rekombinant vektörünün yapısı...52 Şekil pbt10β nın şematik modeli...53 Şekil pnw33nβ nın oluşturulmasının şematik modeli...56 Şekil 4.1. Orijinal bakteriler ile B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerinin antibiyotik içermeyen test plaklarında karşılaştırılması...60 Şekil 4.2. Orijinal bakteriler ile B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerinin kloramfenikol içeren test plaklarında karşılaştırılması...60 Şekil 4.3. Test plaklarının boyanması ile rekombinant ve orijinal bakterilerin enzimatik aktivitelerinin karşılaştırılması...61 Şekil 4.4. Rekombinant B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerden izole edilen pc194α vektörlerin Hind III enzimi ile XI

14 kesim analizi...62 Şekil 4.5. Rekombinant ve orijinal bakterilere ait toplam proteinlerin SDS-PAGE de karşılaştırılması...63 Şekil 4.6. Rekombinant ve orijinal bakterilerin α-amilaz aktivitelerinin SDS-Nişasta-PAGE de karşılaştırılması...64 Şekil 4.7. Denatüre edilmiş ve edilmemiş B. subtilis kökenli proteinlerin SDS-Nişasta-PAGE de Coomassie blue (A) ve iyodin (B) boyaması ile gösterilmesi...65 Şekil 4.8. β-amilaz genine ait PCR ürününün %0.8 lik agaroz jeldeki elektroforezi...66 Şekil 4.9. LB/Agar/Amp/Xgal plaklarında rekombinant (beyaz) ve non-rekombinant (mavi) E. coli XL1 Blue MRF' kolonilerinin gelişimi...67 Şekil Transformasyon plağından aktarılan E. coli/pbluescriptβ kolonilerinin iyot buharıyla boyanması sonucu β-amilaz (+) olanların tespiti...68 Şekil Bazı β-amilaz (+) kolonilerle (2,5,6,8,13,19,20) 1 adet β-amilaz (-) kontrol kolonisinin (K) tek bir plakta bir arada gösterilmesi...68 Şekil β-amilaz (+) koloniler ile bir adet β-amilaz (-) koloniden izole edilen plazmid DNA ların Bam HI enzimi ile kesim reaksiyonunun agaroz jel elektroforezi...69 Şekil β-amilaz geninin klonlanmasına ilişkin kapsamlı analiz...70 Şekil B. subtilis BR151, B. subtilis BR151/pUB110β, B. amyloliquefaciens, B. amyloliquefaciens/pub110β bakterilerinin LB/Nişasta/Agar ve LB/Nişasta/Agar/Kan plaklarında koloni gelişimleri bakımından karşılaştırılması...72 Şekil Orijinal ve rekombinant bakterilerin 37 ve 60 ºC de inkübe edilmiş LB/Nişasta/Agar plaklarında iyot boyaması ile test edilmesi...73 Şekil Orijinal ve rekombinant bakterilerin 37 ve 60 ºC de inkübe edilmiş LB/Nişasta/Agar/Kan plaklarında iyot boyaması ile test edilmesi...73 Şekil pub110β nın kesim ve PCR analizleri...74 XII

15 Şekil LB/Agar/Amp plağında gelişen ve pbt10β plazmidi taşıyan rekombinant E. coli/pbt10β kolonileri...75 Şekil pbt10β taşıyan rekombinant E. coli/pbt10β kolonilerinin 37 ve 60 ºC de inkübe edilmiş LB/Nişasta/Agar/Amp plaklarında iyot boyaması ile gösterilmesi...76 Şekil pbt10β DNA sının PCR ve kesim analizi...77 Şekil pnw33nβ taşıyan rekombinant E. coli/pnw33nβ kolonilerinin LB/Nişasta/Agar/Cml plaklarında iyot boyaması ile gösterilmesi...78 Şekil pnw33nβ nın kesim ve PCR analizi...79 Şekil β-amilaz geni taşıyan bakterilere ait toplam proteinlerin SDS-PAGE de gösterilmesi...80 Şekil β-amilaz geni taşıyan bakterilerin SDS-Nişasta-PAGE de zymogram analizi...80 XIII

16 SİMGELER VE KISALTMALAR A, G, C, T : Adenin, Guanin, Sitozin, Timin Amp/Amp R bç Blm/Blm R CMC CMCaz Cml/Cml R dk DNA EDTA Kan/Kan R kbç L LB M ma MCS Md mg ml mm ng : Amfisilin/Amfisilin direnç geni : Baz çifti : Bleomisin/Bleomisin direnç geni : Karboksimetilselüloz : Karboksimetilselülaz : Kloramfenikol/Kloramfenikol direnç geni : Dakika : Deoksiribonükleikasit : Etilendiamintetraasetik asit : Kanamisin/Kanamisin direnç geni : Kilobaz çifti : Litre : Luria Bertani : Molar : Miliamper : Çoklu klonlama bölgesi (Multiple cloning side) : Megadalton : Miligram : Mililitre : Milimolar : Nanogram XIV

17 PCR pmol R.O. RNA RNaz SDS SDS-PAGE Tet/Tet R U V X-gal α β μf μg μl μm Ω : Polimeraz zincir reaksiyonu (Polymerase Chain Reaction) : Pikomol : Replikasyon orijini : Ribonükleikasit : Ribonükleaz : Sodyum dodesil sülfat : Sodyum dodesil sülfat poliakrilamit jel elektroforezi : Tetrasiklin/Tetrasiklin direnç geni : Ünite : Volt : 5-Bromo-4-chloro-3-indolyl β-d-galactopyranoside : Alfa : Beta : Mikrofarat : Mikrogram : Mikrolitre : Mikromolar : Ohm XV

18 1. GİRİŞ Bahri Devrim ÖZCAN 1. GİRİŞ Bugün başlı başına bir endüstri konusu olan enzimlerin insanlar tarafından ilk kullanımı antik dönemlere kadar dayanmakta olup, o dönemlerde peynir, mayalı ekmek, bira, şarap, sirke gibi gıdaların üretimi ile deri, çivit ve keten işlemede kullanılıyordu (Kirk ve ark., 2002). Fakat modern üretim tekniklerinin devreye girmesiyle enzim endüstrisi son yarım yüzyılda büyük bir gelişim göstermiştir. Buna paralel olarak enzim biyoteknolojisi de önemli aşamalar kaydederek, endüstriyel öneme sahip enzimlerin daha saf, ucuz ve bol miktarda üretilmelerine olanak tanımıştır. Öyle ki endüstriyel enzim üretiminin dünya pazarındaki payı 1995 yılında 1 milyar Dolar iken, bu rakam 2000 yılında 1.5 milyar Dolar a çıkmıştır (Kirk ve ark., 2002) yılında ise milyar Dolar arasında olacağı tahmin edilmektedir (Godfrey ve West, 1996). Bu enzimlerin endüstriyel kullanım alanlarına göre dağılımına bakıldığında, %29 unun gıda sektöründe, %15 inin hayvan yemi sektöründe, %56 sının ise genel teknik alanlarda kullanıldığı görülmektedir (Kirk ve ark., 2002; Schallmey ve ark., 2004) Endüstriyel Enzimlerin Üretim Kaynakları Günümüzde tanımlanmış ve karakterize edilmiş birkaç bin enzim bulunmaktadır. Bu enzimlerin yaklaşık 30 tanesi 1980 yılında ticari olarak üretilmekte ve kullanılmakta iken, günümüzde bu rakam ikiye katlanmıştır ve her geçen yıl sayıları daha da artmaktadır. Günümüzde bu enzimler başta mikroorganizmalar olmak üzere bitkiler ve hayvanlar tarafından üretilmektedir. Bu enzimlerin üretiminde en büyük pay mikroorganizmalara ait olup, yaklaşık %90 ı bu organizmaların fermantasyonu ile sağlanmaktadır (Godfrey ve West, 1996). Enzim üretiminde mikroorganizmaların bu kadar yüksek bir paya sahip olması, üretimi artırmak için modifiye edilmiş mikroorganizmaların kullanımını zorunlu hale getirmiştir. Bu amaçla genetik mühendisliği teknikleri ile rekombinant suşlar geliştirilmiş ve enzim üretiminde kullanılmaya başlanmıştır. Enzim üretiminde Bacillus subtilis, Aspergillus niger ve Aspergillus oryzae gibi mikroorganizmalar en yaygın kullanılan enzim kaynaklarıdır (Glazer ve Nikaido, 1995). 1

19 1. GİRİŞ Bahri Devrim ÖZCAN Bitkisel kökenli enzimlere örnek olarak proteazlardan papain, bromelain ve ficin, soya fasulyesi lipoksigenazı ve tahıl amilolitik enzimleri verilebilir. Bu enzimlerden özellikle papain ve bromelain saflaştırılarak kullanıma sunulması için oldukça uygun olanlarıdır. Bitkisel kökenli enzimlerin artan talebe karşılık verebilmesi, toprak işleme etkinliği, gelişim döngüsü ve iklim gibi birkaç faktöre bağlıdır. Ayrıca tarımsal etkinlikleri kontrol eden ulusal ve uluslararası politik kuruluşların çalışmaları da önemli bir faktör olarak görülmektedir (Godfrey ve West, 1996). Hayvansal kökenli enzimlere ise pankreatik lipaz ve proteazlar, pepsinler, pregastrik esterazlar ve rennetler örnek olarak verilebilir. Bitkisel kökenli enzimlerin üretiminde olduğu gibi hayvansal kökenli enzimlerin üretiminde de, kesim için yetiştirilen hayvanları kontrol eden politik ve tarımsal kuruluşların izledikleri politikalar etkin rol oynamaktadır. Bir çok ülkede yerli ticari hayvan populasyonlarının korunması, hayvanların ve hayvansal dokuların bir ülkeden diğerine taşınmasında katı kısıtlamaların uygulanmasına sebep olmaktadır. Diğer taraftan hastalıkların (özellikle viral hastalıkların) hayvanlar ve hayvansal dokular vasıtasıyla bir ülkeden diğerine yayılması büyük endişelere sebep olmaktadır. Bütün bu sebepler hayvan ve hayvansal ürün ticaretini oldukça kısıtlamaktadır. Bitkisel ve hayvansal kökenli enzimlerin üretilmesinde karşılaşılan bu sorunlar mikrobiyal kökenli enzimlere olan ilginin artırmasını sağlamıştır (Godfrey ve West, 1996). Endüstride kullanılan enzimlerin yaklaşık %75 i hidrolitik olup büyük bir kısmı Bacillus suşları tarafından üretilmektedir (Harwood, 1992). Bacillus suşları endospor oluşturan, çomak şeklinde, patojen olmayan ve doğada hemen her yerde bulunan Gram (+) bakterilerdir (Harwood, 1992; Vehmaanperä, 1990; Özcan, 1996a; Özcan ve Özcan, 2001). Patojen olmamaları ve çeşitli endüstriyel enzimleri üretmelerinden dolayı gen klonlama çalışmalarında önemli bir yere sahip olan Bacillus suşları, sentezledikleri enzimleri hücre dışına salgılama yeteneğindedirler. Bacillus lar tarafından sentezlenen başlıca enzimler arasında α-amilaz, β-amilaz, ksilanaz, alkalin fosfataz, β-glukanaz (selülaz), glukoz izomeraz, β-laktamaz, nötral proteaz ve pullulanaz gibi enzimler sayılabilirler (Harwood, 1992; Özcan ve Uyarlar, 1996). Bu mikroorganizma grubu tarafından üretilen enzim miktarı dünya genelinde 2

20 1. GİRİŞ Bahri Devrim ÖZCAN üretilen toplam enzim miktarının yaklaşık %50 sini oluşturmaktadır (Schallmey ve ark., 2004). Bacillus tarafından üretilen enzimlerin büyük bir kısmı nişasta, tekstil, meyve suyu, biracılık, deterjan ve yem sanayisinde kullanılmaktadır. Bu enzimlerden özellikle α-amilaz ve selülaz (karışık bağlı β-glukanaz), kanatlı rasyonlarında kısıtlı kullanıma sahip arpanın rahatça kullanılmasına olanak sağlamaktadır (Özcan ve ark., 1994). Bacilluslar ve diğer mikroorganizmalar tarafından üretilen enzimler içerisinde özellikle sıcaklığa dirençli olanlar özel bir öneme sahiptir. Sıcaklığa dirençli enzimler genellikle termofilik organizmalar tarafından üretilmekte olup, bu enzimlerin sıcaklığa karşı olan doğal dirençlilikleri endüstriyel alanda önem kazanmalarının başlıca nedeni olmuştur Termofiller ve Sıcaklığa Dirençlilik Termofillerin hücre duvarının yapı taşı olan satüre edilmiş yağ asitleri, hücre için hidrofobik bir çevre sağlayarak yüksek sıcaklığa karşı bakteriye dirençlilik kazandırmaktadır (Herbert ve Sharp, 1992). Hipertermofillerin hücre duvarında ise eterle bağlanmış lipitler bulunmaktadır. Bu yapı, yüksek sıcaklığa karşı yağ asitlerine oranla daha fazla dirençlilik sağlamaktadır (De Rosa ve ark., 1994). Hipertermofilik bakteriler optimum olarak ºC arasında gelişirler. Bu organizmalar tarafından sentezlenen enzimlerin (hipertermofilik enzimler) yapısal ve fonksiyonel özellikleri yüksek sıcaklıklara dayanabilecek şekilde gelişmiştir ve bu enzimler 70 ºC nin üzerinde optimum bir aktiviteye sahiptirler. Hatta bu enzimlerin bazıları 110 ºC nin üzerinde dahi aktivite gösterebilmektedirler. Bunun yanı sıra termofilik bakteriler ise genellikler ºC arasında gelişim göstermekte olup bu organizmalarca sentezlenen enzimler mezofilik ve hipertermofilik enzimler arasında bir sıcaklık direnci gösterirler. Bu enzimlerin optimum sıcaklık aktivitesi ºC dir. Gerek hipertermofilik, gerekse termofilik enzimler tipik olarak 40 ºC nin altında etkin bir aktivite gösteremezler (Vieille ve Zeikus, 2001; Andrade ve ark., 1999; Burg, 2003; Gomes ve Steiner, 2004). 3

21 1. GİRİŞ Bahri Devrim ÖZCAN Hipertermofilik ve termofilik enzimler (termozimler) ekstremozimler isimli başka bir enzim kategorisinin üyesidirler. Ekstremozim grubu enzimler yüksek tuz seviyelerinde (halozimler), yüksek alkali koşullarında (alkalozimler) ve diğer ekstrem koşullar altında (basınç, yüksek asidite vs) fonksiyon gösterebilirler (Vieille ve Zeikus, 2001). Yüksek sıcaklık, tuz ve alkali ortamı ile diğer ekstrem koşullarda da aktivite göstermeleri bu enzimleri endüstriyel kullanım için uygun hale getirmiştir. Bu enzimlerden bazıları, elde edildikleri organizmalar ve endüstriyel kullanım alanları Çizelge 1.1. de verilmiştir. Çizelge 1.1. Bazı önemli termofilik ve hipertermofilik enzimlerin kaynakları ve endüstriyel uygulamaları (Andrade ve ark., 1999; Vieille ve Zeikus, 2001; Gomes ve Stainer, 2004) Enzim Opt. Sıcaklık (ºC) Kaynağı Uygulamaları α-amilaz 70 (150 ppm Ca 2+ ) Bacillus amyloliquefaciens Nişastanın hidrolizi (20 ppm Ca 2+ ) Bacillus licheniformis Nişastanın hidrolizi Bacillus stearothermophilus Nişastanın hidrolizi 100 Pyrococcus furiosus Nişastanın hidrolizi 100 Pyrococcus woesei Nişastanın hidrolizi 97 Pyrodictium abyssi Nişastanın hidrolizi 120 Methanococcus jannaschii Nişastanın hidrolizi β-amilaz 75 Thermoanaerobacterium thermosulfurogenes Maltoz üretimi 95 Thermotoga maritima Maltoz üretimi Glukoamilaz 70 Clostridium thermosaccharolyticum Glukoz üretimi Pullulanaz 98 Pyrococcus furiosus Glukoz üretimi 100 Pyrococcus woesi Glukoz üretimi Bacillus flavocaldarius Glukoz üretimi 90 Thermotoga maritima Glukoz üretimi Glukoz izomeraz 80 Thermoanaerobacterium thermosulfurogenes Fruktoz üretimi Thermotoga maritima Fruktoz üretimi Endoglukanaz 100 Pyrococcus furiosus Glukanın hidrolizi Ksilanaz 100 Thermotoga sp. Ksilanın hidrolizi Meyve suyu sanayi Kağıt sanayi Sellobiyohidrolaz 105 Thermotoga sp. Selülozun hidrolizi 105 Thermotoga maritima Selülozun hidrolizi Kitinaz 80 Streptomyces thermoviolaceus Kitin hidrolizi β-galaktosidaz 80 Thermotoga maritima Laktozsuz süt üretimi β-glukosidaz Pyrococcus furiosus Glukokonjugat sent. β-ksilosidaz 75 Thermoanaerobacterium saccharolyticum Ksiloz üretimi Fitaz 70 Bacillus sp. Fitatın hidrolizi Keratinaz 80 Fervidobacterium pennavorans Tüyün hidrolizi Proteaz S Pyrococcus furiosus Protein hidrolizi Serin Proteaz 90 Thermus sp. Nük. asit saflaştırma Esteraz 100 Pyrococcus furiosus Ester sentezi Taq polimeraz 70 Thermus aquaticus PCR teknolojisi Hidrofobik özellik ile proteinlerin katlanması arasında pozitif bir ilişki bulunmaktadır. Hidrofobik özelliğe sahip proteinler daha etkin bir katlanma yaparak 4

22 1. GİRİŞ Bahri Devrim ÖZCAN yüksek sıcaklıklara karşı daha dirençli hale geçmektedirler. Yine sıcaklığa dirençli proteinlerin amino asit kompozisyonu mezofilik özdeşlerinin amino asit kompozisyonu ile karşılaştırıldığında, glisin yerine alanin, lizin yerine ise arjinin amino asitinin sıcaklığa dirençli proteinlerde daha fazla yer aldığı görülmektedir. Alaninin en iyi sarmal yapı gösteren amino asit olduğu bilinmektedir. Yapılan araştırmalarda da sarmal yapıdaki sıcaklığa dirençli proteinlerin mezofilik özdeşlerinden daha kararlı oldukları gözlenmiştir. Yine yüksek sıcaklık koşullarına en dayanıklı amino asit olarak bilinen arjinin sıcaklığa dirençli proteinlerin yapısında daha fazla bulunurken, sıcaklığa en hassas amino asit olan sistin bu proteinlerin yapısında daha seyrek yer almaktadır. Deneysel çalışmalar hidrofobik interaksiyonların termofilik proteinlerin stabilizasyonunda önemli bir rol oynadığını göstermiştir. Sıcaklığa dirençli proteinler hidrofobik interaksiyonlarla dimer oluşturarak termal hidrolize karşı daha dirençli hale geçmektedirler. Bütün bunların yanı sıra sıcaklığa dirençli proteinler disülfit bağları, aromatik interaksiyonlar, hidrojen bağları, elektrostatik gibi mekanizmalarla yüksek sıcaklıklara karşı direnç gösterebilmektedirler (Kumar ve Nussinov, 2001) Nişastanın Enzimatik Hidrolizi İnsanlar ve birçok hayvan türleri için enerji kaynağı olarak kullanılan nişasta, bitkilerde depo edilen bir karbonhidrattır. Nişasta doğada patates, mısır, pirinç, buğday, bakla başta olmak üzere oldukça yaygın olarak bulunmaktadır. Hayati bir besin maddesi olduğundan nişasta içeren bitkilerin yetiştiriciliği tüm dünya ülkelerinde geniş çapta yapılmaktadır ve yetiştiriciliğinde modern tarım teknikleri kullanılmaktadır. Nişastanın moleküler ağırlığı ile dalton arasında değişmekte olup, bir nişasta molekülü amiloz ve amilopektin olmak üzere iki adet glukoz polimeri içerir (Nielsen ve Borchert, 2000). Nişasta içerisinde genel olarak %10-20 oranında amiloz bulunurken geri kalan kısım amilopektinden oluşmaktadır. Amiloz adet D-glukoz molekülünden ibaret olup, bunlar α-1,4 glukozidik bağları ile birbirlerine bağlanmışlardır. Amilopektin ise α-1,4 bağlarına ilaveten α- 1,6 glukozidik bağlarını da içerir (Şekil 1.1.). Amilopektin düz bir yapı 5

23 1. GİRİŞ Bahri Devrim ÖZCAN göstermesinin yanında 1,6 pozisyonunda dallanma gösterir ve amilopektindeki polimerizasyon derecesi amilozdakinden daha fazladır (Bentley ve Williams, 1996; Lewis, 1996; Bertoldo ve Antranikian, 2002). Şekil 1.1. Nişastanın amiloz ve amilopektin formları (Ersoy ve Bayşu, 1986) α-amilaz enzimi (1-4-α-glukan glukanhidrolaz [EC ]) nişastada bulunan α-1,4 bağları hidrolize ederek onu glukoz, maltoz ve dallanmış oligosakkaritlere parçalar (Strayer, 1981; Özcan ve Uyarlar, 1996). Bu enzimler çok geniş bir organizma grubu tarafından üretilmekte olup geniş ph ve sıcaklık aralıklarında çalışabilmektedirler. Bakteriyel ve fungal α-amilazlar, özellikle Bacillus kökenli α-amilazlar yüksek sıcaklıklara dirençliliklerinden dolayı endüstride yaygın bir kullanım alanı bulmuştur. Diğer taraftan değişik bakteriyel α-amilazların 1.0 dan 11.5 e kadar değişen ph aralıklarında aktivite gösterebildikleri bildirilmiştir (Nielsen ve Borchert, 2000). α-amilaz enzimi β-amilaz ile beraber nişastayı maltoza indirgerken glukoamilazla beraber nişastadan glukoz elde etmede kullanılır (Bentley ve Williams, 1996). Ayrıca α-amilazın fırıncılık sanayinde kullanımı ile iç kalitesi iyi 6

24 1. GİRİŞ Bahri Devrim ÖZCAN olan ve daha geç bayatlayan kaliteli ekmek üretilebileceği de bildirilmiştir (Gray ve Bemiller, 2003) Sıcaklığa Dirençli α-amilazın Nişasta Sanayinde Kullanımı Nişastadan glukoz üretiminde kullanılan asit-hidroliz yönteminde nişastanın ısıtılmasına bağlı olarak hidroksimetilfurfural açığa çıkmakta ve bu maddenin insan sağlığı için zararlı olduğu bilinmektedir. Ayrıca yine asit-hidroliz yönteminde ısıtma işlemine bağlı olarak ( ºC) üründe renk bozulmaları ve kül kontaminasyonu da meydana gelmektedir (Bentley ve Williams, 1996). Gerek asit-hidroliz yöntemindeki bu olumsuzluklar, gerekse enzim üretimindeki gelişmeler sebebiyle günümüzde nişastadan glukoz üretiminde asit-hidroliz yönteminin yerini enzimenzim yöntemi almıştır. Nişasta granülleri 60 ºC nin üzerinde ki bir sıcaklıkta ısıtıldığı zaman (çoğunlukla ºC) nişasta şişmeye ve daha sonrada parçalanmaya başlar. Bu işleme jelatinleşme denir. Bu işlem nişastanın enzim hidrolizine maruz kalması için gereklidir. Daha sonra nişastanın sıvılaştırılması aşaması gelir ve sıcaklığa dirençli α-amilaz enzimi kullanılarak nişasta önce 85 ºC de ve ph de 1 saat süreyle muhafaza edilir. Bu işlemi 140 ºC de kısa süreli ısıtma ve hemen arkasından da 85 ºC ye hızlı bir şekilde soğutma takip eder. Bu işlem nişastanın sıvılaştırılması tamamlanana kadar sürer. Sıvılaştırmadan sonra nişasta hala suda çözünemez durumdadır ve şeker ve dekstrine yıkılmamıştır. Bu işlemden sonra sakarifikasyon işlemi uygulanarak nişasta glukoza yıkılır. Sakarifikasyonda ortam sıcaklığı 60 ºC ye, ph ise 4.1 e ayarlanarak sıvılaştırılmış nişastaya amiloglukosidaz enzimi uygulanır. Reaksiyon süresi ise 60 saattir. Son olarak sırasıyla filtrasyon, deminerilizasyon ve evaporasyon işlemleri uygulanarak glukoz kullanıma hazır hale getirilir (Bentley ve Williams, 1996). Nişastanın hidrolizi ile ilgili sanayide uygulanan işlemler Şekil 1.2. de özetlenmiştir. Mezofil B. licheniformis α-amilazı geniş ph aralığında çalışması, nişastanın işlenmesi esnasında yüksek termo-stabilitesi ve düşük Ca 2+ gereksinmesi ile nişasta sanayinde bugüne kadar diğer bakteriyel α-amilazlardan daha fazla ticari kullanım alanı bulmuştur. B. stearothermophilus α-amilazı bu noktada maliyetinin düşüklüğü, daha iyi substrat çözücülüğü, daha düşük viskositesi, mikrobiyal kontaminasyon 7

25 1. GİRİŞ Bahri Devrim ÖZCAN riskinin daha az olması gibi sebeplerle nişasta sanayinde önemli bir alternatif olmaya devam etmektedir (Wind ve ark., 1994). Şekil 1.2. Nişastanın hidrolizi ile glukoz, fruktoz ve maltoz üretimi (Crabb ve Shetty, 1999 dan modifiye) 1.5. α-amilaz Enziminin Hayvan Beslemede Kullanımı 2002 yılında Dünya genelinde 604 milyon ton karma yem üretimi olmuştur (Gill, 2003). Üretilen bu yemin hayvan gruplarına göre dağılımı Çizelge 1.2. de verilmiştir. Çizelge yılında Dünya genelinde üretilen karma yemin hayvan gruplarına göre dağılımı (Gill, 2003) Hayvan Grubu Yem Üretimi (%) Süt sığırı 17.0 Et sığırı 8.0 Kümes hayvanları 37.0 Domuz 32.0 Su ürünleri 3.0 Diğerleri 3.0 Toplam

26 1. GİRİŞ Bahri Devrim ÖZCAN Enzimler hayvan yemlerine ya besin değeri olmayan çözülebilir lifleri parçalamak yada hayvanların kendi sindirim enzimlerini desteklemek için kullanılabilir. İkinci alternatifin söz konusu olduğu durumda, amilaz ve proteazın, enzimlerin pankreatik salgılanmasının sindirim ihtiyacını tamamen karşılamadığı büyümenin erken evrelerinde kullanılması önerilebilir. Godfery ve West (1996) in bildirdiğine göre Chesson (1990) sütten kesimdeki domuzlarda pankreasta amilaz ve proteaz üretiminin düştüğünü ve domuzların sütten kesim sonrası yemlerine bu enzimlerin eklenmesinin faydalı olacağını bildirmiştir. Ruminantlarda nişastanın rumen yerine ince bağırsakta hidrolizi asidoz riskini azaltmaktadır. Fakat hidrolize olmamış nişastanın kolon (kalın bağırsak) ve sekuma (kör bağırsak) ulaşması durumunda hayvan nişastadan yeterince faydalanamadığı gibi fermentatif asidoza da sebep olabilmektedir (Channon ve Rowe, 2004). Kümes hayvanlarında ise pankreatik amilaz ve proteaz üretiminin kuluçkadan çıkıştan sonra hızla gelişmesine karşılık büyümenin ilk 10 gününde bu enzimlerin eksikliği gözlenebilmektedir (Nir ve ark., 1993). Canoğulları (1999) mısır ve soya fasulyesi küspesine dayalı etlik piliç karma yemlerinde %0.1 düzeyinde α-amilaz enzimi kullanımının, kuru madde tüketimi, canlı ağırlık kazancı, but ve göğüsteki deri ve yağ oranları bakımından daha kaliteli karkas elde edilebileceğini bildirmiştir. Yine benzer bir çalışmada amilaz ve asit proteaz enzimlerince takviye edilmiş mısır-soya yemlemesi ile civcivlerin canlı ağırlık kazancının %20, yemden yararlanma oranının ise %5 düzeyinde arttığı bildirilmiştir (Kobayashi ve ark., 2002). α-amilaz enzimi de içeren ticari enzim karışımları ile yapılan bir çalışmada ise etçi tavuklarda canlı ağırlık ve yemden yararlanmada bir artış meydana geldiği bildirilmiştir (Alam ve ark., 2003) Sıcaklığa Dirençli α-amilazın Yem Sektöründeki Önemi Her enzimin optimum ph değerlerinde belli termal stabilitesi vardır. Bazı enzimler düşük substrat konsantrasyonunda 55 ºC den sonra aktivitelerini kaybetmeye başlar. Bütün yem enzimleri kuru ısıtma işlemi uygulanması esnasında 90 ºC de 30 dakika süreyle kararlı kalabilmektedir. Fakat peletlemede yemlere kuru ısıtma yerine sıcak buhar uygulanmaktadır. Bu işlem esnasında yem materyaline 15 dakika süreyle 85 ºC sıcak buhar uygulanmakta ve eğer gerekli tedbir alınmazsa bu 9

27 1. GİRİŞ Bahri Devrim ÖZCAN işlem enzimlerin aktivitelerini kaybetmelerine sebep olmaktadır. Başka bir deyişle enzimin sıcaklığa dirençliliği, enzimin termal kararlılığı ile kullanılan koruma sisteminin bir kombinasyonudur (Cowan, 1996). Enzimlerin, peletleme esnasında yemlere katılmasında sıcaklığa dirençlilik en önemli koşuldur. Sıcaklığa dirençli α-amilaz, ksilanaz, β-glukanaz gibi enzimlerin kullanılması ile peletleme aşamasında enzim ısıl işlemden etkilenmeyecek ve substrat üzerindeki kararlılığını koruyacaktır. Sıcaklığa dirençlilik özellikle kümes hayvanlarının beslenmesinde kullanılan enzimler için çok önemlidir. Kümes hayvanlarının yemlerine enzim uygulanması ile hayvanlar yem içerisinde bulunan besin maddelerinden daha fazla faydalanabilmektedir. Diğer taraftan mezofilik enzimler ise peletleme aşamasından hemen sonra yemlere spreyleme yöntemiyle uygulanarak kullanılabilmektedir (Cowan, 1996) β-amilaz Enziminin Endüstriyel Kullanımı β-amilaz (EC ) ekzo tip bir enzim olup nişastayı α-1,4-glukozidik bağlarından hidrolize ederek β-anomerik konfigürasyonuna sahip olan ve kristalleşmeyen şeker olarak bilinen maltozu oluşturur (Ziegler, 1999; Kihara ve ark., 1999). β-amilaz enzimi soya, arpa, tatlı patates, pirinç, japon turpu gibi bitkilerin yanı sıra Bacillus polymyxa ve Thermoanaerobacterium thermosulfurogenes (Clostridium thermosulfurogenes) gibi bazı bakterilerce de üretilmektedir (Ramesh ve ark., 2001). Fakat soya, arpa, tatlı patates, pirinç, japon turpu gibi bitkiler ile mezofilik bakterilerce üretilen β-amilazlar oldukça yüksek maliyetle elde edilmekte olup endüstriyel işleme esnasında uygulanan yüksek sıcaklıklara da dayanamamaktadırlar. T. thermosulfurogenes bakterisinden sıcaklığa dirençli β- amilaz enziminin kullanılmaya başlanması ile bu problemler ortadan kalkmış, bunun yanı sıra nişastanın çözünürlüğünü artırarak, viskositesini azaltarak, mikrobiyal kontaminasyon riskini sınırlayarak ve reaksiyon süresini azaltarak daha ekonomik bir üretimin gerçekleşmesine olanak tanımıştır. Sıcaklığa dirençli β-amilaz enzimi kullanılarak üretilen maltoz ve malto-oligosakkaritler gıda, meyve suyu ve eczacılık sektöründe oldukça yaygın olarak kullanılmaktadır (Reddy ve ark., 1999a; Reddy ve 10

28 1. GİRİŞ Bahri Devrim ÖZCAN ark., 1999b; Ramesh ve ark., 2001). Diğer taraftan β-amilazın α-amilaz, limitdekstrinaz ve α-glukosidazla birlikte bira üretiminde kullanılması, kaliteli malt ve malt mayası üretimi için oldukça önemlidir. Fakat bu enzimlerin sıcaklığa dirençli olmaları ayrı bir önem taşımaktadır. Çünkü ısıl işlem uygulaması esnasında enzimlerin inaktivasyonu malt mayası üretiminde ciddi sıkıntılar oluşturmaktadır (Kihara ve ark., 1999). Bütün bunların dışında β-amilaz enzimi tekstil, deterjan ve yapıştırıcı sanayinde de α-amilaz enzimiyle beraber kullanılmaktadır (Liu ve ark., 2003) Araştırmanın Amacı Bu tezin amacı, özellikle nişasta sanayi için büyük önem taşıyan sıcaklığa dirençli α-amilaz ve β-amilaz enzimlerini üreten rekombinant bakteriler geliştirmek ve bu enzimlerin bol ve ucuz bir şekilde üretilmelerine olanak sağlamaktır. Bu sebeple, önce sıcaklığa dirençli α-amilaz genini B. subtilis YB886 ve B. subtilis BR151 suşlarına ilk defa aktararak bu enzimi üreten rekombinant bakterilerin geliştirilmesi düşünülmüştür. Daha sonra, sıcaklığa dirençli β-amilaz genini daha önce klonlanmamış olan ara konakçı E. coli de ve sonra da B. subtilis ile B. amyloliquefaciens bakterilerinde klonlamaktır. Özellikle β-amilaz geninin B. amyloliquefaciens bakterisinde klonlanması ile sıcaklığa dirençli α- ve β-amilaz enzimlerinin bir arada ürettirilmesi amaçlanmıştır. Çünkü B. amyloliquefaciens bakterisi kalsiyum bağımlı sıcaklığa dirençli α-amilaz enzimi üreten bir bakteridir Araştırmanın Kapsamı Bu tezin kapsamı aşağıda maddeler halinde özetlenmiştir: A) Sıcaklığa Dirençli α-amilaz Geni İle İlgili Kapsam 1. B. stearothermophilus a ait sıcaklığa dirençli α-amilaz genini, üretim suşları olmasının yanı sıra daha önce bu genin klonlanmadığı B. subtilis YB886 ve B. subtilis BR151 de klonlayarak enzimi sıcaklık uygulamasıyla saflaştırmak. 2. Sıcaklığa dirençli α-amilaz genini taşıyan bakterilerden rekombinant plazmidi izole ederek insört analizi yapmak. 11

29 1. GİRİŞ Bahri Devrim ÖZCAN 3. Sıcaklık uygulaması ile mezofilik bakterilerden saflaştırılan sıcaklığa dirençli α- amilaz enzimlerini SDS-PAGE ve SDS-Nişasta-PAGE de göstermek. 4. Sıcaklığa dirençli α-amilaz genini taşıyan rekombinant suşlar ile orijinal suşları antibiyotik içeren ve içermeyen LB/Agar plaklarında karşılaştırmak. B) Sıcaklığa Dirençli β-amilaz Geni İle İlgili Kapsam 1. T. thermosulfurogenes e ait sıcaklığa dirençli β-amilaz genini PCR tekniği ile T. thermosulfurogenes kromozomundan çoğaltarak, bu geni daha önce klonlanmamış olan ara konakçı E. coli de klonlamak. 2. Sıcaklığa dirençli β-amilaz genini pub110 aracılığıyla B. subtilis BR151 ve B. amyloliquefaciens bakterilerinde klonlamak. 3. Sıcaklığa dirençli β-amilaz genini Streptococcus thermophilus bakterisinde klonlamak için E. coli/s. thermophilus mekik vektörü olan ve Ç.Ü.Z.F. Zootekni Bölümü Hayvansal Biyoteknoloji ve Genetik Mühendisliği Laboratuarı nda geliştirilen pl2 rekombinant vektörüne takmak. 4. Sıcaklığa dirençli α-amilaz enzimi ile sıcaklığa dirençli β-amilaz enziminin bir arada üretimini sağlamak amacıyla, sıcaklığa dirençli β-amilaz geninin B. stearothermophilus da klonlamak için E.coli/B.subtilis/B.stearothermophilus mekik vektörü olan pnw33n e takmak. 5. Sıcaklığa dirençli β-amilaz geninin takıldığı rekombinant vektörleri izole ederek insört ve PCR analizlerini göstermek. 6. Sıcaklığa dirençli β-amilaz geni taşıyan rekombinant suşlar ile orijinal suşları LB/Agar plaklarında fenotipik olarak karşılaştırmak. 12

30 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN 2. ÖNCEKİ ÇALIŞMALAR 2.1. Sıcaklığa Dirençli α-amilaz Genine İlişkin Önceki Çalışmalar Aiba ve ark. (1983), B. stearothermophilus a ait sıcaklığa dirençli α-amilaz genini ptb90 ve ptb53 plazmidleri aracılığıyla B. stearothermophilus ve B. subtilis te klonlamışlardır. Araştırıcılar rekombinant B. stearothermophilus un gen verici B. stearothermophilus dan 5 kat daha fazla α-amilaz enzimi ürettiğini, B. stearothermophilus ve B. subtilis in birbirinden farklı türler olmasına karşın her iki bakterinin de ürettikleri enzimler arasında önemli bir farklılık bulunmadığını ve son olarak moleküler ağırlığı dalton olan enzimin 80 C de 60 dakika inkübasyonu sonucu aktivitesinin yaklaşık %60 ını muhafaza ettiğini bildirmişlerdir. Mielenz (1983), B. stearothermophilus a ait sıcaklığa dirençli α-amilaz genini izole ederek E. coli de klonlamıştır. Araştırıcı elde ettiği ve α-amilaz üreten dört adet rekombinant koloninin 5.4 kbç lik Hind III kesim noktalı DNA parçasını içeren pbr322 plazmidini taşıdıklarını bildirmiştir. Piggott ve ark. (1984), B. licheniformis RPO1 suşuna ait sıcaklığa dirençli α- amilaz genini B. subtilis te klonlamışlardır. Araştırıcılar rekombinant plazmidin restriksiyon endonükleaz analizi sonucunda, klonlanan α-amilazın daha önce B. licheniformis FDO2 suşundan klonlanan sıcaklığa dirençli α-amilaz ile özdeş olduğunu, B. coagulans a ait sıcaklığa dirençli α-amilaz ile de büyük benzerlikler gösterdiğini bildirmişlerdir. Srivastava (1984), B. stearothermophilus dan hücredışı ve hücreiçi α- ve β- amilazları saflaştırarak aydınlatmıştır. Araştırıcı hücredışı ve hücreiçi α- ve β- amilazın moleküler ağırlıklarını sırasıyla , , ve dalton olarak bulmuştur. Araştırıcı α-amilaz ın amino asit profilini incelemiş, enzimin protein yapısının toplam 16 amino asitten meydana geldiğini, enzimin yapısında en fazla aspartik asit bulunduğunu ve bunu glutamik asit ile lösin amino asidinin takip ettiğini bildirmiştir. Ayrıca enzimi diğer sıcaklığa dirençli α-amilazlarla karşılaştırmış ve prolin ile histidin amino asit miktarlarının daha düşük olduğunu 13

31 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN belirtmiştir. Son olarak araştırıcı hem α-amilaz hem de β-amilazın aktif bölgelerinde enzim aktivitesi için gerekli olan SH grubunun bulunduğunu bildirmiştir. Srivastava ve ark. (1984), termofil Bacillus sp. AK-2 suşundan hücreiçi (intraselülar) sıcaklığa dirençli amilazları izole ederek saflaştırmışlardır. Araştırıcılar ph ve sıcaklık optimumu sırasıyla 6.5 ve 68 ºC olan ham enzimi DEAE-selüloz kolon kromotografi yöntemiyle saflaştırdıklarını bildirmişlerdir. Enzimin birbirinden ayrılabilen üç parçasına (FI, FII, FIII) ait nişastayı hidrolize etme özelliğinin, ph nın 8.5 den 7.0 a çekilmesiyle azaltıldığı, bu üç parçaya ait elektroforetik deneylerin tek bir bant verdiği, ortama 20 mm kalsiyum ilavesinin üç parçanın da aktivitesini artırdığı, optimum sıcaklığın her üçü içinde 65 ºC, optimum ph nın ise FI ve FIII için 6.0, FII için ise 6.5 olduğu da bildirilmiştir. Araştırıcılar ayrıca amilaz molekülündeki SH grubunun enzim aktivitesi için gerekli olduğunu, Ca 2+, Mg 2+, Sr 2+ ve Mn 2+ iyonları dışında çalışılan diğer bütün metal iyonlarının α- ve β-amilaz aktivitesinin her ikisini de inhibe ettiklerini, EDTA nın doza bağlı inhibisyon gösterdiğini bildirmişlerdir. Araştırıcılar FI ve FIII ün α-amilaz, FII nin ise β-amilaz tip bir enzim olduğunu da bildirmişlerdir. Tsukagoshi ve ark. (1984), B. stearothermophilus DY-5 suşuna ait 6.4 kbç lik ve sıcaklığa dirençli α-amilaz genini taşıyan DNA parçasını pbr322 vektörü aracılığıyla E. coli de klonlamışlardır. Araştırıcılar, geni bozmayacak şekilde 6.4 kbç lik parçanın büyüklüğünü azaltmaya yönelik yaptıkları çalışmada, α-amilaz geninin Hind III - Bam HI kesim bölgeleri ile 3.1 kbç lik bir parçanın içinde bulunduğunu bildirmişlerdir. Enzim üzerinde yaptıkları çalışmada, α-amilaz geninin E. coli içerisinde de kararlı kaldığını ve etkili bir şekilde eksprese edildiğini bildirmişlerdir. Ayrıca E. coli tarafından üretilen α-amilaz enziminin B. stearothermophilus tarafından üretilen α-amilaz ile tamamen benzer özellikler taşıdığını, maksimum aktivite aralığının C olduğunu, 80 C de 15 dakika inkübasyondan sonra aktivitesinin yaklaşık %100 ünü koruduğunu belirtmişlerdir. Son olarak araştırıcılar enzimin E. coli de periplazmik bölgede toplandığını, moleküler ağırlığının dalton olduğunu ve bu özelliği bakımından B. stearothermophilus tarafından üretilen enzim ile çok büyük benzerlik gösterdiğini bildirmişlerdir. 14

32 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN Ihara ve ark. (1985), daha önce B. stearothermophilus dan klonlanan sıcaklığa dirençli α-amilaz geninin baz dizilerini okumuşlardır. Araştırıcılar NH 2 - terminal amino asit dizi analizi sonucu genin 1644 bç ve 548 amino asitten meydana geldiğini göstermişlerdir. Ayrıca araştırıcılar B. stearothermophilus α-amilaz genine ait amino asit dizilerinin diğer bakteriyel ve ökaryotik α-amilaz genlerine ait amino asit dizileri ile karşılaştırılması sonucu enzimatik olarak fonksiyonel bölgelerde, 3 homolog dizi bölgesinin bulunduğunu da bildirmişlerdir. Mielenz ve Mickel (1985), B. stearothermophilus ATCC e ait sıcaklığa dirençli α-amilaz genini taşıyan DNA parçasını pbr322, pbr325 ve pwl625 vektörlerini kullanarak E. coli de, pc194 vektörünü kullanarak da B. subtilis te klonlamışlardır. Araştırıcılar bu çalışma ile elde ettikleri rekombinant E. coli ve B. subtilis bakterilerine patent almışlardır. Nakajima ve ark. (1985), B. stearothermophilus α-amilaz genine ait DNA baz dizilerini ortaya çıkarmışlar ve genin 1647 bç ve 549 amino asitten meydana geldiğini göstermişlerdir. Araştırıcılar NH 2 -terminal amino asit dizi analizi sonucu ekstraselülar amilazın 515 amino asit içerdiğini ve moleküler ağırlığının dalton olarak bulunduğunu bildirmişlerdir. Son olarak araştırıcılar sıcaklığa dirençli α-amilaz geninin B. amyloliquefaciens e ait sıcaklığa dirençli α-amilaz geni ile %61 homoloji gösterdiğini de bildirmişlerdir. Thudt ve ark. (1985), B. staerothermophilus a ait sıcaklığa dirençli α-amilaz genini (amy) taşıyan pca43 plazmid DNA sını Staphylococcus carnosus a aktarmışlardır. Araştırıcılar amy geninin hibrit plazmid pamy7 nin 5.4 kbç büyüklüğündeki DNA parçasına lokalize olduğunu bildirmişlerdir. Araştırıcılar pamy7 plazmid DNA sını diğer staphylococcal türlerine de transforme ettiklerini, bütün türlerin süpernatantlarında (hücredışı sıvı) bulunan α-amilazın %80 den fazla aktiviteye sahip olduklarını, en aktif suşun ise Staphylococcus aureus olduğunu bildirmişlerdir. Yine araştırıcılar α-amilaz enzimi üzerinde yaptıkları çalışmalarda moleküler ağırlığını dalton, optimum ph ve sıcaklık değerlerinin ise sırasıyla ve 65 ºC olduğunu bildirmişlerdir. 15

33 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN Gray ve ark. (1986), B. stearothermophilus ve B. licheniformis e ait sıcaklığa dirençli α-amilaz genlerini E. coli de ayrı ayrı klonlayarak ilgili genlerin DNA baz dizilerini okumuşlardır. Ayrıca araştırıcılar vektör aracılığıyla her iki geni klonlayarak elde ettikleri rekombinant E. coli suşlarının ürettikleri enzimlerin gen verici bakterilerin ürettikleri enzimler ile benzerlik gösterdiklerini de bildirmişlerdir. Srivastava ve Baruah (1986), B. stearothermophilus un gelişimi ve sıcaklığa dirençli α-amilazın üretimi için en uygun koşulları araştırmışlardır. Araştırıcılar B. stearothermophilus un kompleks ve yarı sentetik besiyerinde amino asitlerce desteklenmiş sentetik besiyerine göre daha iyi gelişim gösterdiğini, buna karşılık sığır ekstraktı veya ıslatılmış mısır suyu içeren kompleks besiyerinde sıcaklığa dirençli α-amilaz üretiminin, %0.4 pepton içeren yarı sentetik besiyerine göre daha fazla olduğunu, bununla birlikte sentetik besiyerinin sıcaklığa dirençli α-amilaz üretimi için yeterince uygun bir besiyeri olmadığını bildirmişlerdir. Araştırıcılar α- amilaz üretimi için en uygun substratların nişasta>dekstrin>glikojen>sellobiyoz> maltohekzaoz-maltopeptaoz>maltotetraoz-maltotrioz şeklinde sıralandığını bildirirken, inositol ve D-sorbitol un amilaz üretimini artırdığını buna karşılık monosakkaritlerin ise baskıladığını bildirmişlerdir. Ayrıca araştırıcılar organik ve inorganik asitlerin amilaz üretimini artırdığını, izolösin, sistein, fenilalanin ve aspartik asit başta olmak üzere amino asitlerin amilaz sentezi için önemli olduğunu, CaCl 2 2H 2 O içeren besiyerinde amilaz üretiminin daha fazla olduğunu, Tween-80 ve Triton X-100 deterjanlarının biomass üretimini artırdıklarını buna karşılık amilaz üretimini baskıladıklarını bildirmişlerdir. Son olarak araştırıcılar enzimin sıcaklık ve ph optimumlarının sırasıyla 82 C ve 6.9 olduğunu, enzimin sıcaklığa dirençliliği için Ca 2+ un gerekli olduğunu da bildirmişlerdir. Lin ve Tsay (1987), daha önce izole ettikleri B. stearothermophilus Q8 suşuna ait sıcaklığa dirençli α-amilaz enzimini saflaştırmışlardır. Araştırıcılar enzimin ph 9.0, 8.0 ve 10.0 da sırasıyla %100, %98 ve %41 aktivite gösterdiklerini, genin optimum eksprese sıcaklığının 90 ºC olduğunu, 100 ºC de enzimin aktivitesinin %81 ini koruduğunu, 10 mm Ca 2+ varlığında enzimin 100 ºC de 15 dakika inkübasyonu sonucu aktivitesinin %67 sinin muhafaza edildiğini, substrat içermeyen fakat Ca 2+ içeren ortamda enzimin 90 ºC de 2 saat inkübasyonu 16

34 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN sonucunda aktivitesinin ancak %10 u koruduğu, 0.1 ve 1 mm konsantrasyonlarındaki Na + ve 0.1 mm konsantrasyonundaki Mn 2+ katyonları ile 10 mm konsantrasyonlardaki OH, Cl, I, HCO 3, NO 2 ve N 3 anyonlarının teşvikleyici (stimülatör) etki gösterdiğini buna karşılık ortama üre ve KMnO 4 ilavesinin enzim aktivitesinde düşmeye sebep olduğunu, düşük konsantrasyonlarda SDS ve Tween 80 ilavesi durumunda enzim aktivitesinin korunduğunu, fruktoz, mannoz, ksiloz ve laktozun enzim aktivitesi üzerinde hafif inhibitör etki gösterirken galaktoz ve maltozun hiçbir inhibitör etki göstermediğini bildirmişlerdir. Araştırıcılar son olarak enzimin polisakkaritleri oransal olarak hidrolize etme sırasının amiloz > çözünür nişasta = mısır nişastası > glikojen şeklinde olduğunu da bildirmişlerdir. Sohma ve ark. (1987), B. stearothermophilus A631 suşundan sıcaklığa dirençli α-amilaz genini (amyt631) önce pbr322, daha sonra da pub110 plazmid DNA larına klonlamışlar, elde ettikleri rekombinant plazmidi de ptub607 olarak isimlendirmişlerdir. Araştırıcılar enzimin olgunlaşmasına kadar geçen süreci araştırmak için amyt631 genini ptub607 vektöründen BAL31 enzimi ile keserek çıkarmışlar ve ptub285 e tekrar takmışladır. Elde ettikleri rekombinant plazmidi B. subtilis e aktararak üç adet kimerik plazmidi (ptub613, ptub616, ptub617) izole ettiklerini bildirmişlerdir. Srivastava (1987), bir B. stearothermophilus suşu tarafından üretilen sıcaklığa dirençli α-amilaz enzimini 4 basamak süren bir işlemden sonra saflaştırmış ve birbirinden ayrılabilir iki enzim fraksiyonunu NaCl gradient elusyon ile DEAEselüloz-kolum da ayırmıştır. Araştırıcı enzimatik analizler sonucu fraksiyon I in α- amilaz, fraksiyon II nin ise β-amilaz aktivitesi gösterdiğini bildirmiştir. Her iki enzimi de poliakrilamid jelde incelemiş ve α-amilaz ın moleküler ağırlığını dalton, β-amilaz ın moleküler ağırlığını ise dalton olarak hesaplamıştır. Ayrıca araştırıcı saflaştırılmış amilazın 80 C sıcaklıkta ve ph 6.9 da maksimum aktivite gösterdiğini, yine amilaz aktivitesi için Fe 3+, Cd 2+, Pb 2+, Hg 2+, Ni 2+ ve Ag 1+ nın güçlü inhibitör, Zn 2+, Mg 2+, Mn 2+ ve Al 3+ un ılımlı inhibitör, Ca 2+, Ba 2+, Sr 2+ ve K + nın ise stimülatör (Ca 2+ >Ba 2+ >Sr 2+ >K + ) elementler olduğunu bildirmiştir. 17

35 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN Suominen ve ark. (1987a), B. stearothermophilus a ait sıcaklığa dirençli α- amilaz genini EMBL3 λ faj vektörünü kullanarak E. coli de klonlamışlardır. Daha sonra araştırıcılar aynı geni bu sefer puc8 ve pbr322 vektörlerinde tekrar klonlamışlardır. Araştırıcılar genin büyüklüğünü 1650 bç ve enzimin moleküler ağırlığını ise dalton olarak bildirmişlerdir. Ayrıca araştırıcılar enzimin B. amyloliquefaciens ve B. licheniformis e ait α-amilazlar ile benzerlik gösterdiğini de bildirmişlerdir. Son olarak enzimin E. coli nin periplazmik boşluğuna salgılandığını, fakat büyümenin durağan fazında besiyerinde yeterli miktarda α-amilaza rastlanıldığı da bildirilmiştir. Suominen ve ark. (1987b), E. coli de klonlanmış B. stearothermophilus a ait sıcaklığa dirençli α-amilaz enziminin aşırı üretiminin dış zara (outer-membrane) zarar vererek periplazmik proteinlerin hücreler arası (extracellular) lokasyonuna sebep olduğunu göstermişlerdir. Ayrıca araştırıcılar α-amilaz geninin laczpo kontrolü altındaki uzun süreli yüksek ekspresyonu hücrelerin lize olmasına sebep olduğunu bildirmişlerdir. Fakat araştırıcılar genin λ fajının P L promotorunun kontrolü altında ekspresyonu ile periplazmik proteinlerin toplam hücre lizizine neden olmadan büyüme ortamına salgılandığını, λ P L kontrolü altında α-amilazın besi ortamında birikiminin 24 saat boyunca sürdüğünü bildirmişlerdir. Son olarak araştırıcılar besi ortamına Mg 2+ ilavesinin normal üreme kinetiğini onardığını da bildirmişlerdir. Oriel ve Schwacha (1988), B. stearothermophilus a ait sıcaklığa dirençli α- amilaz genini E. coli de klonlamışlardır. Araştırıcılar elde ettikleri rekombinant enzimin gen verici Bacillus tarafından üretilen enzim ile biyokimyasal özelliklerinin aynı olduğunu bildirmişlerdir. Her iki enzimin de moleküler ağırlığı dalton, Ca +2 iyonu varlığında sıcaklığa dirençleri 90 ºC olarak bildirilmiştir. Ayrıca araştırıcılar L besiyeri içerisinde ekstraselülar enzim üretiminin çok kısıtlı olduğunu, gliserol veya nişasta içeren minimal besiyerinde organizma gelişiminin baskılandığını da bildirmişlerdir. Son olarak araştırıcılar gliserol ve nişasta içeren besiyerinde α-amilaz üretimi artmış doğal mutantları izole ettiklerini de belirtmişlerdir. 18

36 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN Satoh ve ark. (1988), daha önce B. stearothermophilus DY-5 suşundan klonlanmış sıcaklığa dirençli α-amilaz geninin bazı B. stearothermophilus suşlarına ait sıcaklığa dirençli α-amilaz genleri ile yapısal benzerliklerini karşılaştırmışlardır. Araştırıcılar α-amilaz geninin DY-5 suşuna ait α-amilaz geni ile ve suş 799 olarak simgelenen bir grup B. stearothermophilus suşuna ait α-amilaz genleri ile benzer olduğunu bildirmişlerdir. Ayrıca araştırıcılar genin fenotipik olarak α-amilaz bakımından yetersiz DSM2334 suşlarının tamamında belirlenemediğini de bildirmişlerdir. Araştırıcılar 5S rrna ve ribozomal proteinlerin eletroforetik örneklerine bakarak DY-5 suşu ile DSM2334 suşlarının birbirleriyle benzer olduğunu, buna karşılık 799 nolu suşun bunlara daha uzak olduğunu bildirmişlerdir. Pechàň ve ark. (1989), B. amyloliquefaciens α-amilazı ile benzer özellikler gösteren α-amilaz genlerini taşıyan pbda318, puba10, puba11 ve puba20 plazmidlerini taşıyan B. subtilis suşlarını antibiyotik seleksiyonuna tabi tutmadan 50 generasyon boyunca kültüre almışlar ve plazmid ve α-amilaz genlerinin varlığı bakımından taramışlardır. Araştırıcılar çalışma sonunda puba11 plazmidinin endüstriyel enzim üretimi için uygun olduğunu, diğer suşların ise yapısal ve enzim salgılaması yönünden aynı uygunluğu göstermediklerini bildirmişlerdir. Petříček ve ark. (1989), Thermomonospora curvata CCM 3312 ye ait Hind III Bam HI kesimli ve 2.6 kbç büyüklüğündeki sıcaklığa dirençli α-amilaz genini (tam) Streptomyces lividans TK 24 te klonlayarak ilgili enzimin bu bakterice üretilmesini sağlamışlardır. Scheirlinck ve ark. (1989), B. stearothermophilus a ait sıcaklığa dirençli α- amilaz geni ile Clostridium thermocellum a ait endoglukanaz genlerini elektroporasyon tekniği ile ticari Lactobacillus plantarum suşuna transforme etmişlerdir. Araştırıcılar rekombinant suşların heri iki enzimi de ürettiklerini, fakat plazmid DNA üzerinde bulunan genlerin sınırlı miktarda enzim ürettiklerini, bu sebeple her iki geni de L. plantarum un kromozomuna rekombinasyon ile entegre ettiklerini bildirmişlerdir. Araştırıcılar elde ettikleri rekombinant suşların selülolitik silaj kültürü olarak kullanılabileceğini de bildirmişlerdir. 19

37 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN Sen ve Oriel (1989a), B. stearothermophilus ATCC29609 (BR135) a ait plazmid DNA fragmenti ile B. stearothermophilus ATCC31195 (BR132) e ait kromozomal DNA fragmentini pbr322 plazmidinde klonlayarak E. coli HB101 suşuna transforme etmişlerdir. Araştırıcılar transformant koloniler arasından sıcaklığa dirençli α-amilaz genini taşıyan kolonileri seçerek geni aydınlatmışlardır. Araştırıcılar hibridizasyon deneylerinin sıcaklığa dirençli α-amilaz geninin her iki plazmid içerisinde de Hind III kesim noktaları arasında 3.2 kbç lik bir DNA parçasından meydana geldiğini, hem BR135 hem de BR132 içerisinde çoklu kromozomal kopya sayısına ulaştıklarını bildirmişlerdir. Ayrıca araştırıcılar sıcaklığa dirençli α-amilaz enzimini saflaştırarak enzimin 58 kda moleküler ağırlığına sahip bir proteinden meydana geldiğini de göstermişlerdir. Sen ve Oriel (1989b), B. stearothermophilus ATCC29609 (BR135) suşuna ait sıcaklığa dirençli α-amilaz genini önce pbr322 plazmid DNA sında, sonrada B. subtilis - E. coli mekik vektöründe tekrar klonlamışlardır. Araştırıcılar pss099 plazmidini taşıyan E. coli HB101 suşunun 5 µg/ml kloramfenikol içeren L besiyerinde 70 U/ml hücredışı α-amilaz ürettiğini bildirmişlerdir. Yine araştırıcılar bu miktarın pss076 plazmidi taşıyan E. coli hücrelerinin ürettiği α-amilaz miktarının yaklaşık 2 katı kadar olduğunu göstermişlerdir. Son olarak araştırıcılar α-amilazın 58 kda ağırlığında bir protein olduğunu da bildirmişlerdir. Jørgensen ve ark. (1990), yeni ve güvenilir bir DNA füzyon metodunu yayınlamışlardır. Araştırıcılar bu metodu daha önce B. stearothermophilus dan klonlanmış α-amilaz geninin B. subtilis te üretim verimliliğini artırmak için kullanmışlar ve B. licheniformis α-amilaz geninin nükleotid dizileri ile B. stearothermophilus α-amilaz geninin nükleotid dizileri arasında tam bir füzyonu sağladıklarını bildirmişlerdir. Araştırıcılar sonuçta B. subtilis te doğru olarak çalışan ve her iki enzim aktivitesini de gösteren hibrid translasyonal proteini elde ettiklerini bildirmişlerdir. Khosravi ve ark. (1990), B. stearothermophilus a ait sıcaklığa dirençli α- amilaz genini puc8 plazmidine takarak pmk57 rekombinant plazmid DNA yı elde etmişlerdir. Daha sonra araştırıcılar pmk57 vektörüne bakteriyel hemoglobin genini 20

38 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN de takarak bu sefer rekombinant pmk79 vektörünü oluşturmuşlardır. Araştırıcılar her iki rekombinant vektörü de (pmk57 ve pmk79) E. coli JM103 suşuna transforme ettiklerini, bu plazmid DNA ları alan suşların her ikisinin de α-amilaz enzimi ürettiğini, ayrıca pmk79 u alan kolonilerin α-amilaz enzimi yanında hemoglobini de ortama salgıladığını bildirmişlerdir. Vihinen ve Mäntsälä (1990), B. stearothermophilus α-amilazını karakterize etmişlerdir. Geni B. stearothermophilus, B. subtilis ve E. coli de klonlayarak enzimi bu üç mikroorganizmada da ürettirmişlerdir. Araştırıcılar saflaştırdıkları enzimin konukçuya bakmaksızın benzer özellikler taşıdığını, sıcaklık optimumunun C, ph optimumunun olduğunu ve enzimin 80 C ve ph de 1 saat inkübasyonu sonucu kararlılığını koruduğunu bildirmişlerdir. Ayrıca enzimin Ca 2+, Na + ve bovine serum albumin tarafından stabilize edildiği, 70 C de 5 gün veya 90 C de 45 dakika inkübasyonu ile aktivitesinin yaklaşık %50 sini koruduğu, Cd 2+, Cu 2+, Hg 2+, Pb 2+ ve Zn 2+ nin enzim için inhibitör metal iyonları olduğu, buna karşılık EDTA, ethylene glycol bis(β-aminoethyl ether) N,N,N',N'-tetraacetic acid ve tendamistatın inhibitör etki göstermediği, enzimin 55 veya 70 C de aseton veya etanol ile 30 dakika inkübasyonu sonucu tamamen aktifleştiği, %1 lik SDS nin enzim stabilitesini etkilemezken 70 C de ve 6 M üre varlığında enzimin tamamen denatüre olduğu da bildirilmiştir. Son olarak araştırıcılar enzimin moleküler ağırlığının dalton, pi değerinin ise 8.8 olarak bulunduğunu da bildirmişlerdir. Cocconcelli ve ark. (1991), B. stearothermophilus a ait sıcaklığa dirençli α- amilaz genini taşıyan rekombinant ppsc22 plazmid DNA sını değişik Lactobacillus suşlarına aktararak enzimin üretimini gerçekleştirmişlerdir. Diderichsen ve ark. (1991), B. stearothermophilus a ait sıcaklığa dirençli α- amilaz genini (AmyS) yeni geliştirilmiş bir yöntemle (in vivo rekombinasyonla gen füzyonu) B. subtilis te klonlamışlardır. Araştırıcılar AmyS geninin B. subtilis te ekspresyonunu artırmayı amaçladıklarını fakat buna karşılık AmyS genini B. licheniformis de klonlayarak daha iyi ürünler elde ettiklerini bildirmişlerdir. Jørgensen ve ark. (1991), doğadan izole ettikleri bir B. stearothermophilus suşundan sıcaklığa dirençli α-amilaz genini klonlayarak DNA baz dizi analizini 21

39 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN yapmışlardır. Araştırıcılar, daha önce başka araştırıcıların B. stearothermophilus α- amilaz genlerinin yerli plazmid üzerinde bulunabileceğini bildirdiklerini belirterek kendi izole ettikleri B. stearothermophilus suşunun α-amilaz geninin kromozom üzerinde bulunduğunu bildirmişlerdir. Lee ve ark. (1994), sıcaklığa dirençli ve alkalifilik Bacillus sp. XAL601 suşunu topraktan izole ettiklerini ve bu suşun sıcaklığa dirençli ve alkalin-kararlı α- amilaz ve pullulanaz aktivitesine sahip bifonksiyonel bir enzim ürettiğini bildirmişlerdir. Araştırıcılar, bu suşa ait α-amilaz-pullulanaz genini (aapt) klonlayarak genin baz dizilerini belirlediklerini, genin bazdan meydana geldiğini ve dalton moleküler ağırlığında amino asit içeren bir enzimi şifrelediğini göstermişlerdir. Araştırıcılar genin C-terminal bölgesinde Gly-Ser-Gly- Thr-Thr-Pro amino asit dizilişinin 12 kez tekrar ettiğini de bildirmişlerdir. Ayrıca araştırıcılar aapt genini E. coli de sub-klonladıklarını ve genin lac promotorunun kontrolü altında çalıştığını, enzim aktivitesi için optimum sıcaklık ve ph değerlerinin sırasıyla 70 ºC ve 9.0 olduğunu ve son olarak enzimin ºC sıcaklıkta ve ph da ham nişastayı parçaladığını da bildirmişlerdir. Wind ve ark. (1994), bir patates işleme endüstrisinden yüksek derecede sıcaklığa dirençli α-amilaz üreten yeni bir B. stearothermophilus suşunu izole etmişler, enzimin yarı ömrünü 80 C de 5.1 saat, 90 C de 2.4 saat olarak belirlediklerini bildirmişlerdir. Ayrıca enzimin optimum çalışma sıcaklığını 70 C, ph sını ise olarak bulmuşlardır. Araştırıcılar bakterinin büyüme oranı ile enzim üretimi arasında ters bir ilişki bulduklarını, enzimin düşük nişasta konsantrasyonu ve düşük sıcaklıklarda bakterice daha iyi üretildiğini, bakterinin 65 C de en iyi üreme göstermesine karşılık enzimin en iyi 40 C de sentezlendiğini bildirmişlerdir (65 C de 3.9 U/ml enzim üretirken 40 C de 143 U/ml enzim üretilmiştir). Gobbetti ve ark. (1996), sıcaklığa dirençli α-amilaz genini içeren pc194amy plazmid DNA sını elektroporasyonla Lactobacillus sanfrancisco CB1 bakterisine aktararak geni bu bakteride eksprese etmişlerdir. Araştırıcılar amilaz aktivitesinin hücredışı olduğunu ve 140 generasyon boyunca aktivitesini koruduğunu, ayrıca transformant bakterilerin 10 gr nişasta/l ve 5 gr maltoz/l içeren 22

40 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN besiyerinde gelişimlerinin gen verici bakteri ile benzer olduğunu bildirmişlerdir. Son olarak araştırıcılar pgkv210, pnz12 ve pmg36 plazmid DNA larını yine elektroporasyon yöntemi ile L. sanfrancisco CB1 bakterisine aktardıklarını da bildirmişlerdir. Özcan (1996b), sıcaklığa dirençli bir bakteri olan B. stearothermophilus a ait sıcaklığa dirençli α-amilaz genini, kendi α-amilaz geni mutasyonla köreltilmiş B. subtilis suşuna protoplast füzyonu yöntemi ile aktarmıştır. Araştırıcı elde edilen fuzant suşun B. subtilis gelişme sıcaklığı olan 37 ºC de geliştiğini fakat sıcaklığa dirençli α-amilaz enziminin bu sıcaklıkta ortamda inaktif olarak kaldığını, sıcaklığın B. stearothermophilus un gelişme sıcaklığı olan 55 ºC ye getirilmesi ile enzimin aktif hale geçerek nişastayı parçaladığını bildirmiştir. Sidhu ve ark. (1997), topraktan izole ettikleri amilolitik ve sıcaklığa dirençli Bacillus sp. MK716 bakterisine ait 100 C de dahi aktivitesini muhafaza edebilen bir α-amilaz genini ethylmethane sulfonate ile muamele ederek mutasyona uğratmışlar ve bu şekilde enzim üretimini 40 kat artırmışlardır. Daha sonra araştırıcılar mutasyona uğramış sıcaklığa dirençli α-amilaz genini pbr322 plazmid DNA sı ile E. coli de klonlayarak 4.8 kbç lik genin baz dizilerini okumuşlardır. Araştırıcılar son olarak geni de içeren 2.0 kbç lik fragmenti B. subtilis te klonlayarak enzim üretimini 107 kat daha artırdıklarını bildirmişlerdir. Ali ve ark. (1999), Tunus da sıcak su kaynağına ait topraktan bir Bacillus sp. US100 suşunu izole etmişlerdir. Araştırıcılar bu suş tarafından salgılanan termoaktif amilazın optimum aktivite sıcaklığının 82 C olduğunu, enzimin 110 C de ve %20 (w/v) lik substrat varlığında yarılanma ömrünün 40 dakika olduğunu bildirmişlerdir. Araştırıcılar enzimin nişasta üzerindeki aktivitesi sonucu açığa çıkan son ürünün maltohekzaoz ve maltopentaoz olduğunu, ayrıca α-amilaz aktivitesi gösteren 3 kbç lik DNA fragmentini put57 vektörü ile E. coli de klonladıklarını da bildirmişlerdir. Mamo ve Gessesse (1999), AmyI ve AmyII olarak isimlendirdikleri iki adet α-amilazı termofil Bacillus sp. WN11 suşunun hücredışı sıvısından (süpernatant) saflaştırmışlardır. Araştırıcılar AmyI ve AmyII nin moleküler ağırlıklarını sırasıyla 76 23

41 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN ve 53 kda olarak bildirmişlerdir. 60 C de ve 1 U/mg dozunda enzim uygulandığında ham patates ve mısır nişastalarının hidroliz yüzdeleri AmyI için sırasıyla %77 ve %44, AmyII için ise sırasıyla %82 ve %37 olarak bildirmişlerdir. Ayrıca araştırıcılar her iki enzimin de ph optimumunu 5.5, sıcaklık optimumunu C olarak bildirirken, yine her iki enzimin de 80 C de 4 saat inkübasyonu ile aktivitelerinin yaklaşık %50 sini koruduğunu ve optimum ph aralıklarının olduğunu da bildirmişlerdir. Son olarak araştırıcılar enzimlerin Hg 2+, Cu 2+ ve Fe 3+ varlığında inhibe olurken Zn 2+ varlığında inhibe olmadıklarını da göstermişlerdir. Beaujean ve ark. (2000), ilk defa bifonksiyonel bir genle patatesten direk olarak glukoz ve fruktozu elde ettiklerini bildirmişlerdir. Araştırıcılar bunun için B. stearothermophilus a ait sıcaklığa dirençli α-amilaz geni ile Thermus thermophilus a ait sıcaklığa dirençli glukoz izomeraz genlerini füzyona soktuklarını ve böylece bifonksiyonel bir gen elde ettiklerini bildirmişlerdir. Ayrıca araştırıcılar elde ettikleri bu enzimatik kompleksin 65 ºC de aktivite gösterdiğini de belirtmişlerdir. Chakraborty ve ark. (2000), topraktan izole ettikleri B. stearothermophilus suşuna ait sıcaklığa dirençli α-amilaz enzimini saflaştırarak aydınlatmışlardır. Araştırıcılar enzimin moleküler ağırlığını SDS-PAGE de 64 kda olarak belirlemişlerdir. Yine araştırıcılar enzimin çok geniş ph aralığında çalıştığını, maksimum aktivitesini ph 7.0 da gösterdiğini, sıcaklık toleransının 100 ºC olduğunu ve bu sıcaklıkta %90 oranında katalitik aktivitesini koruduğunu, optimum aktivitesini ise en iyi 50 ºC de gösterdiğini bildirmişlerdir. Ali ve ark. (2001), B. stearothermophilus US100 e ait maltohekzaoz formundaki α-amilazı osmotik şok, nişasta adsorbsiyonu ve anyon değişim kromatografiden oluşan bir kombinasyonla saflaştırdıklarını bildirmişlerdir. Araştırıcılar enzimin 549 amino asitten meydana geldiğini, moleküler ağırlığının 59 kda olduğunu ve diğer B. stearothermophilus α-amilazları ile büyük bir benzerlik gösterdiğini bildirmişlerdir. Araştırıcılar bu benzerliğin özellikle DY-5 ve DN1792 suşlarına ait α-amilazla en yüksek düzeye çıktığını bildirmişlerdir. 24

42 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN 2.2. Sıcaklığa Dirençli β-amilaz Genine İlişkin Önceki Çalışmalar Hyun ve ark. (1985), Thermoanaerobacterium thermosulfurogenes (Clostridium thermosulfurogenes) ve Clostridium thermohydrosulfuricum üzerine yaptıkları bir araştırmada bu iki bakteriyi birbiriyle karşılaştırmışlar ve araştırma sonunda T. thermosulfurogenes in glukoz, maltoz ve nişasta içeren besiyerinde C. thermohydrosulfuricum dan daha hızlı ürediğini, her iki suşun da glukoz içeren ortamda nişasta veya maltoz içeren ortama göre daha hızlı geliştiklerini bildirmişlerdir. Araştırıcılar C. thermohydrosulfuricum da glukoamilaz, pullulanaz ve maltazın nişasta ve maltozun glukoza dönüşümüne birinci derecede sorumlu enzimler olurken T. thermosulfurogenes de β-amilazın nişastanın maltoza dönüşümünde birinci derecede sorumlu enzim olduğunu, besiyeri substratı ne olursa olsun nişastanın glukoz ve maltoza dönüşümlerinin T. thermosulfurogenes de C. thermohydrosulfuricum a göre daha yüksek olduğunu bildirmişlerdir. Hyun ve Zeikus (1985), T. thermosulfurogenes de β-amilaz sentezinin düzenlenmesindeki genel mekanizmayı araştırmışlar, β-amilaz geninin sadece maltoz veya maltoz üniteleri içeren diğer karbonhidratların bulunduğu ortamlarda yüksek seviyelerde eksprese edildiğini, buna karşılık glukoz veya sukroz bulunan ortamlarda eksprese edilmediğini, hatta glukoz eklenmesi ile β-amilaz sentezinin hemen baskılandığını bildirmişlerdir. Nanmori ve ark. (1987), Bacillus cereus un orijinaline (yabani-tip) göre yaklaşık 40 kat daha fazla β-amilaz salgılayan bir suşundan, N-methyl-N'-nitro-Nnitrosoguanidine ile mutagenezden sonra BQ10-S1 SpoIII olarak isimlendirdikleri ve 5.5 kattan daha fazla β-amilaz üreten mutant suşu izole ettiklerini bildirmişlerdir. Araştırıcılar suşun amilaz üretiminin ortama %0.5 glukoz veya %1 maltoz ilave edildiğinde arttığını, hatta %2 çözünür nişasta ilavesi durumunda daha fazla bir artış olduğunu bildirmişlerdir. Araştırıcılar son olarak bu suş tarafından üretilen enzimin yabani-tip enzimle immünolojik olarak benzer olduğunu, suş içerisinde ya genin kopya sayısının, ya enzim sentezindeki etkinliğin yada her ikisinin de arttığını bildirmişlerdir. Kitamoto ve ark. (1988), T. thermosulfurogenes e ait sıcaklığa dirençli β- amilaz genini B. subtilis de klonlayarak baz dizilerini okumuşlardır. Araştırıcılar β- 25

43 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN amilazın 519 amino asit dizisinden meydana geldiğini, moleküler ağırlığının ise dalton olduğunu bildirmişlerdir. Yine araştırıcılar T. thermosulfurogenes β- amilazının amino asit dizilerinin Bacillus polymyxa, soya fasulyesi ve arpa β- amilazlarının amino asit dizileriyle sırasıyla %54, 32 ve 32 homoloji gösterdiğini, bu dört β-amilazın amino asit dizilerinin arasında 12 adet çok iyi korunmuş bölgenin bulunduğunu bildirmişlerdir. Araştırıcılar, sıcaklığa dirençli T. thermosulfurogenes β-amilazının mekanizmasını aydınlatmak için, enzimin amino asit dizilerini B. polymyxa β-amilazının amino asit dizileri ile karşılaştırmışlardır. Bu karşılaştırma sonucunda T. thermosulfurogenes β-amilazının B. polymyxa β-amilazından daha fazla sistin içerirken, daha az hidrofilik amino asit içerdiğini göstermişlerdir. Araştırıcılar son olarak, T. thermosulfurogenes β-amilazının amino asit dizileri içerisinde, B. polymyxa β-amilazının birebir karşılık gelen amino asit dizileri ile kıyaslandığında, hidrofobik özelliği önemli ölçüde yüksek olan birkaç bölgenin bulunduğunu belirtmişlerdir. Shen ve ark. (1988), T. thermosulfurogenes e ait ekstraselülar β-amilazı 811 kat saflaştırdıklarını, enzimin genel moleküler, fiziko-kimyasal ve katalitik özelliklerini belirlediklerini bildirmişlerdir. Araştırıcılar enzimin tek-tip subüniteden meydana gelmiş 210 kda moleküler ağırlığında bir tetramer olduğunu, N-ucundaki 20 amino asidin Bacillus polymyxa β-amilazıyla %45 homoloji gösterdiğini belirtmişlerdir. Ayrıca araştırıcılar enzimin asidik ve hidrofobik amino asitlerce zengin olduğunu, saf enzimin izoelektrik noktasının 5.1, optimum ph aktivitesinin 5.5 ve sıcaklık optimumunun ise 75 ºC olduğunu, 80 ºC de sıcaklığa direncinin ortama substrat ve Ca 2+ ilavesi ile artırıldığını, enzimin amilozu maltoz ve amilopektine, glikojeni ise maltoz ve limit-dekstrinlere hidrolize ettiğini, enzimin α- ve β-siklodekstrinlerce inhibe edildiğini de bildirmişlerdir. Son olarak araştırıcılar enzimin kaynatılmış çözünür nişasta için Kcat ve Km değerlerinin sırasıyla dk-1/mol ve 1.68 mg/ml olduğunu, ayrıca enzimin antijenik olarak bitkisel kökenli β- amilazlardan farklılık gösterdiğini de göstermişlerdir. Nipkov ve ark. (1989), çözünür nişasta içeren besiyerinde gelişen T. thermosulfurogenes mutant suşunun ürettiği sıcaklığa dirençli β-amilaz enzimi üzerinde yaptıkları çalışmada, enzimin aktivitesinin uzun periyotlar boyunca kararlı 26

44 2. ÖNCEKİ ÇALIŞMALAR Bahri Devrim ÖZCAN kaldığını bildirmişlerdir. Araştırıcılar enzimin bakterice üretimi için optimum ph ve sıcaklık değerlerinin sırasıyla 6.0 ve 60 ºC olduğunu tespit etmişlerdir. Son olarak araştırıcılar enzim aktivite seviyelerinde ki artışın, büyümenin asetik asit inhibisyonu ile, β-amilaz üretiminin de düşük üreme oranıyla sınırlandırıldığını bildirmişlerdir. Ray ve ark. (1994), Bacillus megaterium B 6 tarafından sentezlenen β- amilazın 60 ºC deki geri dönüşümsüz termoinaktivasyon çalışmaları sonucu, deaktivasyon (aktivitenin sonlanması) mekanizmasının muhtemelen enzimin aktif bölgesinde bulunan thiollerin oksidasyonu sonucu oluştuğunu bildirmişlerdir. Araştırıcılar ayrıca birkaç deneme sonucu Mn 2+ nın enzimin sıcaklığa dirençliliğini artırmada ve inaktive olmuş enzimin kısmen de olsa aktifleşmesinde rol oynadığını bildirmişlerdir. Reddy ve ark. (1999a), T. thermosulfurogenes SV2 kültürüne Triton X-100, CHAPS, Tween-80 ve sodium taurocholate surfaktantlarının eklenmesi ile sıcaklığa dirençli β-amilaz ve pullulanaz üretiminin arttığını bildirmişlerdir. Araştırıcılar, surfaktantların bakteri kültürüne inkübasyondan 18 saat sonra eklenmesi ile enzim üretiminin uyarılmasının daha fazla olduğunu, sırasıyla 1.0 mm Triton X-100, 0.1 mm CHAPS, 0.1 mm Tween-80 ve 0.1 mm sodium taurocholate kullanılması durumunda T. thermosulfurogenes in kontrol grubuna göre sırasıyla %140, 34, 88 ve 28 daha fazla β-amilaz, %114, 146, 47 ve 28 daha fazla da pullulanaz ürettiğini bildirmişlerdir. Ayrıca araştırıcılar surfaktantların ilavesinin enzim üretimini artırması yanında enzimlerin ekstraselülar üretilerek hücre dışına salgılanmasını teşvik ettiğini ve enzim stabilitesini artırdığını, buna karşılık bütün bu surfaktantların bakteri gelişimi için çok az bir inhibitör etkiye sahip olduğunu tespit etmişlerdir. Ramesh ve ark. (2001), T. thermosulfurogenes SV2 bakterisini kullanarak sıcaklığa dirençli β-amilaz ve pullulanaz enzimlerinin üretimi üzerinde değişik unların etkilerini araştırmışlardır. Araştırıcılar PYE bazal besiyerine ekledikleri unlar arasında, enzim üretimi için en iyi substratın patates unu olduğunu, optimum koşullar altında T. thermosulfurogenes SV2 nin kültür besiyerine 0.87 U/ml β-amilaz, 0.98 U/ml pullulanaz ürettiğini bildirmişlerdir. 27

45 3. MATERYAL VE METOD Bahri Devrim ÖZCAN 3. MATERYAL VE METOD 3.1. Materyal Bakteri, Plazmid ve Büyüme Ortamları Bu çalışmada kullanılan Bacillus stearothermophilus (ATCC12980), Bacillus subtilis YB886, Bacillus subtilis BR151 ve Bacillus amyloliquefaciens bakterileri Bacillus Genetic Stock Center (The Ohio State University, Colombus) dan, Bacillus subtilis ATCC31786/pC194α rekombinant bakterisi, LGC Promochem (Queens Road, Teddington) dan, Thermoanaerobacterium thermosulfurogenes bakterisi DSMZ (Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1b, Braunschweig, Almanya) den, Escherichia coli XL1 Blue MRF' ise Stratagene den temin edilmiştir. Yine çalışmada kullanılan pc194α rekombinant vektörü B. subtilis ATCC31786/pC194α bakterisi içerisinde LGC Promochem (Queens Road, Teddington) dan, pbluescript II KS/SK E. coli klonlama vektörü Stratagene (11011 N. Torrey Pines Road La Jolla, California 92037) den, pub110 vektörü Sigma dan, pnw33n mekik vektörü Bacillus Genetic Stock Center (The Ohio State University, Colombus) dan temin edilmiş, pl2 rekombinant vektörü ise Ç.Ü. Ziraat Fakültesi Zootekni Bölümü Hayvansal Biyoteknoloji ve Genetik Mühendisliği Laboratuvarı nda geliştirilmiş olup pbluescript II KS/SK + ptrw10 replikasyon orijini + bakteriyofaj T4 lizozim geninden ibarettir (Aşan ve ark., 2005). B. stearothermophilus, B. subtilis YB886, B. subtilis BR151, B. subtilis ATCC31786/pC194α ve E. coli bakterileri %15 v/v gliserol içeren LB (Ek 1.1.) besi ortamında -20 C de muhafaza edilmişlerdir. B. stearothermophilus bakterisi LB sıvı besiyerinde 55 C de, B. subtilis YB886, B. subtilis BR151, B. subtilis ATCC31786/pC194α ve E. coli bakterileri ise yine LB sıvı besiyerinde 37 C de aerobik şartlarda üretilmişlerdir. Katı besiyeri olarak LB/Agar (Ek 1.1.) kullanılmıştır. LB/Agara α-amilaz plak testi için %0.5 w/v nişasta, CMCaz plak testi için %0.1 w/v CMC, ksilanaz plak testi için %0.1 w/v ksilan ve likenaz plak testi için ise %0.1 w/v likenan ilave edilmiştir. Besiyerine antibiyotik ilave edilmesi gerektiğinde, uygun konsantrasyonda antibiyotik hesaplanarak stoktan (Ek 1.2.) alınmış ve steril şartlarda besiyerine ilave edilmiştir. 28

46 3. MATERYAL VE METOD Bahri Devrim ÖZCAN T. thermosulfurogenes bakterisi ise seçici besiyerinde (Ek 1.3.) anaerobik şartlarda 60 ºC de üretilmiştir Kimyasallar Çalışmada kullanılan kimyasal malzemeler ile DNA modifiye edici enzimler (DNA kesme enzimleri, RNaz, DNA ligaz, Alkalin fosfataz), DNA polimerazlar (Pfu DNA polimeraz, Taq DNA polimeraz) ve antibiyotikler ile diğer kimyasal malzemeler aksi belirtilmedikçe Sigma, Fermentas, Boehringer Mannheim, Promega, Merck, Stratagene, Carlo Erba, Difco, Gibco BRL ve Oxoid den satın alınmıştır Aletler Çalışmada kullanılan aletlerden santrifüj Hettich (D-78532, Tuttlingen, Almanya) den, PCR cihazı Techne (PRİZMA LTD., Silahtar Caddesi Kosem Apt. No 56/6, Gazi Mah. Ankara) den DNA ve protein jel elektroforez cihazları ATTO Corporation (2-3, Hongo 7-chome Bunkyo-ku, Tokyo, 113 Japonya) dan, güç kaynakları ATTO Corporation ve E-C Apparatus Corporation (St. Petersburg, Rusya) dan, elektroporasyon cihazı Bio-Rad (Alfred Nobel Drive Hercules, CA 94547) dan, otoklavlar Nüve (Kumrular Sok. 26/2, Kızılay, Ankara) ve Hirayama (2-6-5 Toyono-Cho, Kasukabe-shi, Saitama , Japonya) dan, inkübatör Nüve (Esenboğa Yolu 22. km. Akyurt, ANKARA) den, su banyosu Memmert (Memmert GmbH + Co. KG, Äußere Rittersbacher Str. 38, Schwabach, Almanya) den, Spektroftometreler Pharmacia (Cambridge Science Park, Milton Road, Cambridge CB4 4FJ, İngiltere) dan, hassas terazi Ohaus (29 Hanover Road, Florham Park, NJ 07932, ABD) dan, UV lamba Vilber Lourmat (B.P. 66 Torcy-Z.I.SUD Marne La Vale-Codex, Fransa) dan, vorteks ve manyetik karıştırıcı CAT (M. Zipperer GmbH, D-7813 Staufen-Etzenbach, Almanya) den, steril kabin Bilser (İzmir) den, çalkalayıcı Ika (Janke&Kunkel GmbH&Co KG, Staufen, Almanya) dan, ph metre Nel (Sümer Sok., 42/1, Yenişehir, Ankara) den, otomatik pipetler Biohit ve Socharex den, deepfreez ve no-frost buzdolabı Arçelik den satın alınmıştır. UVP marka agaroz jel görüntüleme cihazı ise Kutay Laboratuar Cihazları Ticaret A.Ş. den satın alınmıştır. 29

47 3. MATERYAL VE METOD Bahri Devrim ÖZCAN 3.2. Metod Bakterilerde α-amilaz Aktivitesinin Belirlenmesi α-amilaz aktivitesi bakımından test edilecek bakteriler önce LB sıvı besiyerinde 37 C de bir gece üretilmişlerdir (Şekil 3.1.). Ertesi gün, üreyen bakterilerden steril öze yardımıyla LB/Nişasta/Agar katı besiyerine çizme yöntemiyle ekimleri yapılmış ve bir gece daha 37 C de inkübasyona bırakılarak koloni oluşturmaları sağlanmıştır. Bakteri kolonileri geliştikten sonra plak iyot buharıyla boyanarak fenotipik tayinleri yapılmıştır. Bunun için bakteri kolonileri gelişmiş petrinin kapağına iyot kristalleri ezilerek konulmuş ve bakteri plağı ters çevrilerek kısa bir süre (1-2 dk) oda sıcaklığında inkübe edilmiştir. İyot buharı nişastalı zemini maviye boyayacağından, maviye boyanmış zeminde etrafında beyazımsı halka oluşan koloniler α-amilaz pozitif bakterilerdir (Şekil 3.3.). Şekil 3.1. Bakterilerin LB sıvı besiyerinde üretilmeleri Bakterilerde CMCaz, Ksilanaz ve Likenaz Aktivitelerinin Belirlenmesi CMCaz, ksilanaz ve likenaz aktivite tayini yapılacak suşlar önce 37 C de bir gece LB sıvı besiyerinde üretilmişlerdir (Şekil 3.1.). Ertesi gün, üreyen bakterilerden steril öze yardımıyla, CMCaz tayini için LB/CMC/Agar, ksilanaz tayini için 30

48 3. MATERYAL VE METOD Bahri Devrim ÖZCAN LB/Ksilan/Agar ve likenaz tayini içinse LB/Likenan/Agar katı besiyerlerine çizme yöntemiyle ekimleri yapılmış ve bir gece daha 37 C de inkübasyona bırakılmışlardır. Bakterilerin Congo-red boyaması ile CMCaz, ksilanaz ve likenaz fenotipik tayinleri yapılmıştır. Bunun için bakteri plağına, yüzeyi kaplayacak miktarda %0.2 w/v Congored boyası dökülmüş, 15 dakika inkübasyondan sonra boya uzaklaştırılarak plağın üzerine bu sefer 1M NaCl solusyonu ilave edilmiş ve 15 dakika daha beklenerek katı besiyerindeki fazla boyanın uzaklaşması sağlanmıştır (Şekil 3.2.). Congo-red CMC, ksilan ve likenanlı ortamı kırmızıya boyayacağından, kırmızıya boyanan zeminde etrafında sarımtırak zon oluşan koloniler CMCaz, ksilanaz ve likenaz pozitif bakterilerdir (Şekil 3.3.). Şekil 3.2. CMCaz, ksilanaz ve likenaz pozitif/negatif suşların Congo-red boyaması ile belirlenmesi 31

49 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Şekil 3.3. α-amilaz +, CMCaz +, ksilanaz + ve likenaz + B. subtilis kolonileri gelişmiş LB/Agar plakları Sıcaklığa Dirençli α-amilaz Geninin B. subtilis Suşlarına Elektroporasyon Tekniği ile Aktarılması B. subtilis YB886 ve BR151 suşlarına sıcaklığa dirençli α-amilaz geninin aktarılmasında pc194α plazmid DNA sı (Şekil 3.4.) kullanılmıştır. pc194α Mielenz ve Mickel (1985) tarafından B. stearothermophilus a ait sıcaklığa dirençli α-amilaz geninin pc194 e klonlanması ile geliştirilmiş rekombinant bir vektör olup yine aynı araştırıcılar tarafından B. subtilis (α-amilaz -, CMCaz +, ksilanaz +, likenaz + ) bakterisine aktarılarak B. subtilis ATCC31786/pC194α rekombinant bakterisi oluşturulmuştur (α-amilaz +, CMCaz +, ksilanaz +, likenaz + ) (Şekil 3.5.). 32

50 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Şekil 3.4. Mielenz ve Mickel (1985) tarafından geliştirilmiş pc194α vektörü Şekil 3.5. B. subtilis ATCC 31786/pC194α bakterisinin farklı substratlar içeren LB/Agar plaklarında fenotipik testi (A: α-amilaz +, B: CMCaz +, C: ksilanaz +, D: likenaz + ) B.subtilis ATCC31786/pC194α Bakterisinden pc194α Rekombinant Vektörünün İzolasyonu B. subtilis ATCC31786/pC194α kolonisinden rekombinant pc194α plazmid DNA sı izolasyonu Hardy (1985) e göre yapılmıştır. İlgili protokol Ek 2.1. de verilmiştir. 33

51 3. MATERYAL VE METOD Bahri Devrim ÖZCAN DNA nın RNaz Enzimi ile RNA dan Arındırılması Bakteriden izole edilen rekombinant plazmid DNA sı Ek 2.2. de verilen protokole göre RNaz enzimi (Ek 1.4.) ile muamele edilerek RNA dan arındırılmıştır pc194α Rekombinant Vektörün B. subtilis YB886 ve B. subtilis BR151 Suşlarına Elektroporasyon Tekniği ile Aktarılması pc194α vektörünün B. subtilis YB886 ve B. subtilis BR151 suşlarına elektroporasyon tekniği ile aktarılması Xue ve ark. (1999) a göre yapılmıştır. İlgili protokol Ek 2.3. de verilmiştir Transformasyon Plaklarından Rekombinant B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Kolonilerinin Seçimi ve Fenotipik Testleri B. subtilis YB886 ve B. subtilis BR151 transformasyon plaklarında gelişen rekombinant koloniler, cam yazar kalemle çizilmiş ve numaralandırılmış LB/Nişasta/Agar/Cml (30 μg/ml kloramfenikol) test plaklarına steril kürdanlarla üçer kopya olacak şekilde ekilmiştir. Ekimi tamamlanan plaklar ters çevrilerek 37 ºC ye ayarlanmış inkübatöre kaldırılmış ve koloni gelişimi için ertesi güne kadar inkübasyonda bırakılmıştır. Ertesi gün plaklardan birer tanesi 55 ºC ye ayarlanmış inkübatöre alınmış ve besi ortamına salgılanan sıcaklığa dirençli α-amilaz enziminin aktifleşerek ortamdaki nişastayı parçalaması için 4 saat süreyle bekletilmiştir. Diğer plaklar ise gene 37 ºC de inkübasyona 4 saat daha devam edilmiştir. Süre sonunda 55 ºC de inkübe edilen plaklarla 37 ºC de inkübe edilen plaklardan birer tanesi alınarak iodin buharı ile boyanmıştır. α-amilaz pozitif zon veren kolonilerden birer tanesi üçüncü kopya test plağından alınarak 50 μg/ml kloramfenikol içeren LB/CMC/Agar/Cml, LB/Ksilan/Agar/Cml ve LB/Likenan/Agar/Cml plaklarına ekimi yapılmış ve 37 ºC de bir gece inkübasyona bırakılmıştır. 34

52 3. MATERYAL VE METOD Bahri Devrim ÖZCAN B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilerin Antibiyotik İçermeyen ve İçeren Besiyerlerinde Koloni Gelişimi Yönünden Karşılaştırılması Rekombinant B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterileri ile orijinal bakteriler antibiyotik içermeyen ve içeren (50 μg/ml kloramfenikol) LB/Agar test plaklarına steril kürdan ile karşılıklı gelecek şekilde ekilmiş ve 37 ºC de 1 gece inkübasyona bırakılmıştır. Ertesi gün test plaklarında gelişen orijinal ve rekombinant bakterilerin koloni oluşumu bakımından karşılaştırması yapılmıştır B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilerin α-amilaz Aktivitesi Bakımından Karşılaştırılması B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterileri ile orijinal bakterilerin geliştiği LB/Nişasta/Agar plakları iyot buharı ile boyanmıştır. Boyama sonucunda rekombinant ve orijinal bakteriler α-amilaz aktivitesi bakımından karşılaştırılmıştır B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilerin CMCaz, Ksilanaz ve Likenaz Aktiviteleri Bakımından Karşılaştırılması B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterileri ile orijinal bakteriler karşılıklı gelecek şekilde CMC, ksilan ve likenan içeren antibiyotikli ve antibiyotiksiz test plaklarının her birine ayrı ayrı ekilerek bakteri gelişimi için 37 ºC de bir gece inkübasyona bırakılmışlardır. Ertesi gün antibiyotik içermeyen test plaklarında gelişen orijinal ve rekombinant bakteriler ile antibiyotik içeren test plaklarında gelişen rekombinant bakteriler Congo-red boyaması ile CMCaz, ksilanaz ve likenaz aktiviteleri bakımından karşılaştırılmışlardır B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α dan İzole Edilen Rekombinant pc194α Plazmidlerinin Kesim Analizi B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α ile kontrol amacıyla B. subtilis ATCC31786/pC194α dan rekombinant pc194α plazmid DNA sı Ek 35

53 3. MATERYAL VE METOD Bahri Devrim ÖZCAN 2.1. de verilen protokole göre izole edilerek Ek 2.2. de verilen protokole göre de RNA dan arındırılmıştır. Daha sonra plazmidler, gen entegrasyonu Hind III enzimi ile yapıldığı için bu enzimle kesilmiştir. Kesim reaksiyonu %0.8 lik agaroz jelde (Ek 1.11.) elektroforeze tabi tutularak UVitec jel görüntüleme cihazı ile fotoğraflanmıştır B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilere Ait Hücredışı Proteinlerin SDS-PAGE ve Zymogram Analizleri SDS-PAGE deneyleri Laemmli (1970)'e göre yapılmıştır (1). SDS-PAGE nin Hazırlanması SDS-PAGE yoğunlukları farklı olan iki ayrı katmandan meydana gelmektedir. Üstteki katman (toplayıcı jel) proteinlerin bir araya gelerek ayırıcı jele beraber girmelerini sağlamaktadır. Ayırıcı jel ise toplayıcı jele göre daha yoğun olup proteinlerin moleküler ağırlığına göre birbirinden ayrılarak bantlar oluşturduğu katmandır. %12 lik SDS-PAGE nin hazırlanışı Ek 1.5. de verilmiştir (2). Hücredışı Proteinlerin TCA Muamelesi İle Elde Edilmesi B. subtilis YB886/pC194α ve BR151/pC194α bakterileri ile orijinal bakterilerden hücredışı proteinler Ek 2.4. de verilen protokole göre TCA muamelesi ile elde edilmiştir. Protein örnekleri üzerine hacmin yarısı kadar kaynatma solüsyonu (Ek. 1.6.) ilave edilerek SDS-PAGE de elektroforez için hazır hale getirilmiştir (3). Elektroforez Aletinin Çalıştırılması Protein örnekleri SDS-PAGE kuyularına bir otomatik pipet yardımıyla konularak elektroforez tankının kapağı kapatılmış ve birer uçları güç kaynağına bağlı olan kabloların diğer uçları da elektroforez tankına bağlanmıştır. Güç kaynağı, proteinler toplayıcı jelde ilerlerken 25 ma ve 100 V da, ayırıcı jelde ilerlerken 40 ma ve 100 V da çalıştırılmıştır. Çift jel kullanıldığı durumlarda ise toplayıcı jelde 40 ma ve 100 V, ayırıcı jelde ise 60 ma ve 100 V da çalıştırılmıştır (Şekil 3.6.). 36

54 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Şekil 3.6. Denatüre proteinlerin elektroforez işlemine tabi tutulması (4). B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilere Ait Toplam Proteinlerin SDS-PAGE de Karşılaştırılması Ek 2.4. e göre elde edilen protein örnekleri %12 lik SDS-PAGE jele yüklenerek uygun volt ve ma değerlerinde proteinlerin jel içerisinde birbirinden ayrılması sağlanmıştır. Proteinlerin jel içerisinde ilerlemesi tamamlandıktan sonra, jel dikkatli bir şekilde iki cam levha arasından çıkarılarak içerisinde boya solüsyonu (Coomassie blue) (Ek 1.8.) bulunan bir kabın içerisine konmuş ve dk süreyle jelin boyanması için beklenmiştir. Boyama tamamlandıktan sonra jel boyadan alınmış ve içerisinde destain solüsyonu (yıkama solüsyonu) (Ek 1.9.) bulunan bir kaba konarak fazla boyanın uzaklaşması sağlanmıştır. Son olarak rekombinant bakteriler ile orijinal bakterilere ait toplam hücredışı proteinler karşılaştırılmıştır (5). B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α Bakterileri ile Orijinal Bakterilerin SDS-Nişasta-PAGE de Karşılaştırılması Protein örnekleri %12 lik SDS-Nişasta-PAGE (%0.2 w/v nişasta) jele yüklenerek proteinlerin jel içerisinde ilerlemesi sağlanmıştır. Proteinlerin jel içerisinde ilerlemesi tamamlandıktan sonra jel Ek 2.5. de verilen protokole göre muamele edilerek α-amilaz enziminden sorumlu bant ortaya çıkarılmıştır. 37

55 3. MATERYAL VE METOD Bahri Devrim ÖZCAN (6). Sıcaklığa Dirençli α-amilaz Enziminden Sorumlu Bandın SDS-Nişasta-PAGE de Gösterilmesi B. subtilis ATCC31786/pC194α bakterisi, B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerine ait hücredışı proteinleri SDS-Nişasta-PAGE de hem iyot hem de Coomassie blue ile boyanarak sıcaklığa dirençli α-amilaz enziminden sorumlu bant gösterilmiştir. Bunun için; Protein örnekleri %12 lik SDS-Nişasta-PAGE (%0.2 w/v nişasta) ye yüklenerek proteinlerin jel içerisinde ilerlemesi sağlanmıştır. Proteinlerin ilerlemesi tamamlandıktan sonra jel Ek 2.5. de verilen protokole göre muamele edilerek α- amilaz enziminden sorumlu bant ortaya çıkarılmıştır (7). Sıcaklık Uygulaması ile Mezofilik Kökenli Proteinlerin Denatüre Edilerek Sıcaklığa Dirençli α-amilazın SDS-PAGE ve SDS-Nişasta-PAGE de Gösterilmesi Rekombinant B. subtilis ATCC31786/pC194α, B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerinden sıcaklığa dirençli α-amilaz enzimi Ek de verilen protokole göre izole edilmiştir. İzole edilen α-amilaz enzimi SDS- Nişasta-PAGE de elektroforez edilmiştir. Ayrıca Ek 2.4. de verilen protokole göre bu üç bakteriye ait toplam proteinler de izole edilerek denatüre edilmeden (kontrol amacıyla) aynı jelde elektroforez edilmiştir. Elektroforezden sonra jel Ek 2.5. de verilen protokole göre muamele edilerek α-amilaz enziminden sorumlu bantlar gösterilmiştir Sıcaklığa Dirençli β-amilaz Geninin Değişik Bakterilerde Klonlanması Sıcaklığa Dirençli β-amilaz Geninin PCR ile Amplifikasyonu T. thermosulfurogenes bakterisi kromozomunda bulunan sıcaklığa dirençli β- amilaz geni PCR ile amplifiye edilerek (çoğaltılarak) değişik vektörler ile ligasyona tabi tutulmuştur. 38

56 3. MATERYAL VE METOD Bahri Devrim ÖZCAN (1). β-amilaz Geninin Amplifikasyonu İçin Primer Dizaynı İnternet taramaları ile T. thermosulfurogenes e ait sıcaklığa dirençli β-amilaz geninin baz dizileri (Çizelge 3.1.) bulunarak alınmıştır (Kitamoto ve ark., 1988). β- amilaz genine ait DNA baz dizileri dikkatli bir şekilde incelenerek, geni T. thermosulfurogenes kromozomundan ayıracak DNA baz dizileri belirlenmiştir. Dizi üzerindeki primer bölgeleri Çizelge 3.1. de çerçeve içerisinde gösterilmiştir. PCR ürününün vektöre ligasyonunu kolaylaştırmak amacıyla yapışkan uç açığa çıkacak şekilde her iki primerin de 5' ucuna Bam HI endonükleazına ait tanıma dizileri (5'- GGATCC-3') ilave edilmiştir. Bam HI endonükleazı; gen bölgesi içerisinde tanıma bölgesine sahip olmaması ve vektör DNA üzerindeki çoklu klonlama bölgesinde (MCS) kesim yapan enzimlerden biri olması gibi önemli unsurlar göz önünde bulundurularak seçilmiştir. Bu kriterler göz ününde bulundurularak dizayn edilen ve β-amilaz genini T. thermosulfurogenes genomundan ayırmada kullanılacak olan primer dizileri Şekil 3.7. de verilmiştir. Primer A: 5 -GAAAGG ATCCTATAATAGCTGGTGCTGTAAAG-3 Fazlalık Bam HI Amplifiye edilecek DNA bölgesiyle Tanıma dizileri hibridlenecek primer sınır dizileri Primer B: 5 -GTTTGGATCCCACCGGAATATATTCCAGTGT -3 Şekil 3.7. β-amilaz genini T. thermosulfurogenes genomundan kopyalayacak primer dizileri 39

57 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Çizelge 3.1. Sıcaklığa dirençli β-amilaz geninin baz dizilimi ve kodladığı proteinin amino asit dizini LOCUS CLOAMYTB 2824 bp DNA linear BCT 26-APR-1993 DEFINITION C.thermosulfurogenes thermophilic β-amylase gene, comp.cds. ACCESSION M22471 VERSION M GI: KEYWORDS amylase. SOURCE Thermoanaerobacterium thermosulfurigenes ORGANISM Thermoanaerobacterium thermosulfurigenes Bacteria; Firmicutes; Clostridia; Thermoanaerobacteriales; Thermoanaerobacteriaceae; Thermoanaerobacterium. REFERENCE 1 (bases 1 to 2824) AUTHORS Kitamoto,N., Yamagata,H., Kato,T., Tsukagoshi,N. and Udaka,S. TITLE Cloning and sequencing of the gene encoding thermophilic beta-amylase of Clostridium thermosulfurogenes JOURNAL J. Bacteriol. 170 (12), (1988) MEDLINE PUBMED COMMENT Original source text: C.thermosulfurogenes (ATCC33743) DNA. Draft entry and computer_readable sequence for [1] kindly submitted by H. Yamagata, 09-FEB FEATURES Location/Qualifiers source /organism="thermoanaerobacterium thermosulfurigenes" /mol_type="genomic DNA" /db_xref="taxon:33950" -35_signal _signal CDS /note="thermophilic beta-amylase (EC )" /codon_start=1 /transl_table=11 /protein_id="aaa " /db_xref="gi:144725" translation="migafkrlgqklfltlltaslifassivtanasiapnfkvfvmg PLEKVTDFNAFKDQLITLKNNGVYGITTDIWWGYVENAGENQFDWSYYKTYADTVRAA GLKWVPIMSTHACGGNVGDTVNIPIPSWVWTKDTQDNMQYKDEAGNWDNEAVSPWYSG LTQLYNEFYSSFASNFSSYKDIITKIYISGGPSGELRYPSYNPSHGWTYPGRGSLQCY SKAAITSFQNAMKSKYGTIAAVNSAWGTSLTDFSQISPPTDGDNFFTNGYKTTYGNDF LTWYQSVLTNELANIASVAHSCFDPVFNVPIGAKIAGVHWLYNSPTMPHAAEYCAGYY NYSTLLDQFKASNLAMTFTCLEMDDSNAYVSPYYSAPMTLVHYVANLANNKGIVHNGE NALAISNNNQAYVNCANELTGYNFSGFTLLRLSNIVNSDGSVTSEMAPFVINIVTLTP NGTIPVTFTINNATTYYGQNVYIVGSTSDLGNWNTTYARGPASCPNYPTWTITLNLLP 40

58 3. MATERYAL VE METOD Bahri Devrim ÖZCAN GEQIQFKAVKIDSSGNVTWEGGSNHTYTVPTSGTGSVTITWQN" ORIGIN 1 bp upstream of MflI site. 5 1 ggatcttagt ttaggtgtgt ttttatacta tggcgcatta aaaggaatac cgacatcttt 61 agatgaagca gctttaatag atggttgtag tagatttaga atctactgga atatcatact 121 gccattatta aatcctacta cgatcaccct tgcagttttg gatattatgt ggatatggaa 181 tgactactta ttgccatctt tagtcataaa caagtcggtt ccaggacgct tccactaatg 241 attttttact tctttagcca gtacacaaag cagtggaatc tcggtatggc aggactgaca 301 atagcaattt tacctgttgt aattttctac ttcttggcac agagaaaatt agtcacagct 361 ataatagctg gtgctgtaaa gcagtaggta aagcaaaatt atagttagga ggtgatatta 421 aaatagaaat ttgatagaaa ctgaatataa ttattgaaag gggtgggaac tattggcaaa 481 ataatatctt attaaaattt ttggcggcaa aaaatagtga ttatattatt tttatcgtat 541 gatgggaggg aaaataaaaa tagatgattg gagcttttaa aaggttgggt caaaaattgt 601 ttttgacatt gttaacggca tcattaattt ttgcatcttc tatagtaact gctaatgcaa 661 gcatagcacc aaatttcaaa gtttttgtaa tgggtccatt agaaaaagtc acagatttta 721 atgcattcaa agatcaattg ataactttaa agaataatgg tgtttatggt ataacaacag 781 atatttggtg gggctatgtt gaaaatgcag gtgaaaatca atttgactgg agttattata 841 agacatatgc tgataccgta cgcgctgcgg gattgaagtg ggttccaata atgtcaacgc 901 atgcctgtgg aggtaatgtt ggtgatacag taaatatacc tattccgtca tgggtatgga 961 caaaagatac ccaagataat atgcagtata aggatgaagc cggaaattgg gataatgaag 1021 cagtaagtcc atggtattct ggcttaaccc aactctataa tgaattttat tcatcttttg 1081 catcaaattt tagcagctat aaagatataa ttactaaaat atatatatct ggaggccctt 1141 ctggagaatt aagatatcct tcatataatc cttcgcatgg atggacatat cctggacgtg 1201 gctcgctgca gtgctatagt aaagcggcta taacaagttt tcaaaatgct atgaagtcta 1261 aatatggaac tatagcagca gttaatagtg catggggtac aagcctaact gatttttctc 1321 aaattagtcc acctacagat ggtgataatt tctttacaaa tggttataaa actacttatg 1381 gtaatgactt tttgacatgg tatcaaagtg ttttgactaa tgagttagcc aatattgctt 1441 ctgtagctca tagctgcttt gatccagtat ttaatgttcc aataggagca aaaatagctg 1501 gagtgcattg gctatataat agtccgacaa tgccacatgc tgcagaatat tgtgccggtt 1561 attataatta tagcacgcta ctcgatcaat ttaaggcatc taatcttgct atgacattta 1621 catgtcttga aatggatgat tctaatgcat atgtaagtcc atattattct gcacctatga 1681 cgttagtcca ttatgtagct aatcttgcta ataataaagg tatagtccac aatggagaaa 1741 atgctttggc tatatccaac aacaatcaag cttatgtgaa ttgtgcaaat gaattaacag 1801 gatataattt ttctggattt acacttttaa gactttcgaa tattgtaaat agtgatggat 1861 ctgtgacatc agagatggct ccttttgtaa ttaatatagt tacactaacg cctaacggta 1921 cgataccagt tacatttaca ataaacaatg cgacaactta ttatggacaa aatgtatata 1981 ttgttggtag tacatctgat cttggaaatt ggaatacaac ctatgcccgt ggtcctgcat 2041 catgccctaa ttatcctact tggacaataa cgcttaatct attacctggt gagcagatac 2101 agtttaaagc tgtaaaaatt gatagttcag gaaatgtaac ttgggaaggt ggctcgaatc 2161 atacttatac tgtgccgaca tctgggactg gtagtgtcac cattacatgg caaaattaat 2221 caataaaatg ttacacatag aacaaattgt aaacactgga atatattccg gtgttttttt 2281 gtatattatg ggcgtttaat gttaaaaata atagtgtttt gattttatta aaaagtttgg 2341 aggtaagaga tgagtaaaaa agttggttat tccaaaaggg cttttatact acaactttta 2401 tcctatgtgg aaaacatttt ttgaagaact gggtgctgaa gtggttactt ccagtgatac 2461 atgtaaaaaa ataattgatg atggcatcaa gacttgcgtg gatgaaacct gccttcctgt 2521 caagacattt atgggtcatg tgattgattt gaaggaaaag ggtgttgatt atatatttgt 2581 tccaagagtc ataagcgtag aaaggcgtag atatctatgc tcaaaatttt tgggtttgcc 2641 tgacttagtg agaaatctta tttctgattt gccacaaata atagatatga agattgatta 2701 ctatcgtgga gaagagttta tggaaagaga aattttgaga gttggcaagc tgtttgttga 2761 tagcacaagt aaaattaaag acgcatacga aaaatcttta aaaaggcaaa ggacttttga 2821 attc 3 41

59 3. MATERYAL VE METOD Bahri Devrim ÖZCAN (2). T. thermosulfurogenes den Kromozomal DNA İzole Edilerek RNA dan Arındırılması T. thermosulfurogenes bakterisi selektif besiyerinde anaerobik şartlarda 60 ºC de üretilmiştir. Üretilen bakteriden Cutting ve Van der Horn (1990) a göre kromozomal DNA izole edilmiştir. İlgili protokol Ek 2.6. da verilmiştir. İzole edilen kromozomal DNA Ek 2.2. de verilen protokole göre RNaz enzimi ile muamele edilerek RNA dan arındırılmıştır. Son olarak DNA nın spektrofotometrede miktarı ve saflık derecesi ölçülerek PCR reaksiyonu için hazır hale getirilmiştir (3). Programlama Primerlerin kalıp DNA ya yapıştığı sıcaklık (T m =annealing sıcaklığı), primer uzunlukları dikkate alınarak her iki primer için de ayrı ayrı hesaplanmıştır. Primerlerin T m değerleri T m = 2(A+T) + 4(G+C) formülü kullanarak hesap edilmiştir. Bu hesaplamaya göre T m değerleri (kalıp ipliğe özgü olan altı çizili diziler); Primer A için (5'-GAAAGGATCCTATAATAGCTGGTGCTGTAAAG-3') T m = 64 ºC ve Primer B için (5 -GTTTGGATCCCACCGGAATATATTCCAGTGT -3 ) T m = 60 ºC dir. Bu durumda annealing sıcaklığı her iki primer için de 58 ºC alınmıştır (Annealing sıcaklığı hesaplanan T m değerinin 2-5 ºC aşağısı alınmaktadır). T m hesaplanırken her iki primerde de kalıp DNA ile homoloji gösteren ve altı çizili olarak verilen diziler hesaba katılmıştır. Çünkü diğer dizilerin kalıp DNA üzerinde komplementeri olmadığından birinci döngüde sarkık olarak kalacaklardır. Dolayısıyla tüm baz dizileri dikkate alınarak T m değerleri hesaplansaydı primerlerin kalıp DNA ya yapışması mümkün olmazdı. İşte bundan dolayı T m değerleri hesaplanırken bu diziler hesaba katılmamıştır. Yukarıdaki açıklamalar doğrultusunda hazırlanan Thermal Cycler programı Çizelge 3.2. de verilmiştir. 42

60 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Çizelge 3.2. β-amilaz geninin T. thermosulfurogenes DNA sından amlifikasyonu için PCR cihazına uygulanan program Program Grupları Sıcaklıklar Süre Döngü Sayısı 1 95 ºC 2 dakika 1 94 ºC 1 dakika 2 58 ºC 2 dakika ºC 3 dakika 3 72 ºC 10 dakika ºC < 24 saat (4). Reaksiyonun Hazırlanması Reaksiyon hazırlanmadan önce reaksiyon bileşenleri tek tek incelenerek, stok kontaminasyonun önlenmesi amacıyla günlük kullanımlar için steril mikrosantrifüj tüplerine paylaştırılmıştır. Günlük stoklar hazırlandıktan sonra mümkün olduğu kadar steril şartlarda ve buz üzerinde, en son enzim ilave edilecek şekilde PCR reaksiyonu hazırlanmıştır. Reaksiyonda, üründe küt uç oluşturacak şekilde sentez yapan ve proofreading aktivitesine sahip Pfu DNA polimeraz enzimi kullanılmıştır. Bu sayede, açığa çıkan PCR ürünü gen küt uçlu olacağı için, yine Sma I enzimi ile küt uç oluşturacak şekilde kesilecek olan pbluescript II KS/SK plazmid DNA sına ligasyonu yapılabilecektir. Sıcaklığa dirençli β-amilaz geninin amplifikasyonu için hazırlanan PCR reaksiyonu bileşenleri Çizelge 3.3. de verilmiştir. Çizelge 3.3. Sıcaklığa dirençli β-amilaz geninin amplifikasyonu için hazırlanan PCR reaksiyonu bileşenleri Cinsi Stok Konsantrasyon Alınan Miktar Son Konsantrasyon T. thermosulfurogenes kalıp DNA sı 4400 ng/μl 0.5 μl 2200 ng Primer A 20 pmol/μl 1 μl 20 pmol Primer B 20 pmol/μl 1 μl 20 pmol dntp karışımı 200 μm (her biri) 1 μl 200 μm (her biri) Reaksiyon tamponu 10 X 5 μl 1 X Pfu DNA Polimeraz 2.5 U/μl 0.5 μl 1.25 U Deionize su - 41 μl - TOPLAM - 50 μl - 43

61 3. MATERYAL VE METOD Bahri Devrim ÖZCAN 0.5 ml lik mikrosantrifüj tüpünde bu şekilde hazırlanan reaksiyon karışımı daha önce programlanmış olan PCR cihazının örnek bloğuna yerleştirilerek cihaz çalıştırılmıştır (5). PCR Ürününün Elektroforezi ve Agaroz Jelden Arıtılması PCR programı tamamlandıktan sonra reaksiyon ürününden 5 μl alınarak üzerine 1 μl 6X yükleme tamponu (Ek 1.10.) ilave edilmiş ve hafifçe pipetlenerek homojenize hale getirilmiştir. Elde edilen karışım markır DNA ile birlikte %0.8 lik agaroz jelin (Ek 1.11.) kuyularına dikkatli bir şekilde yüklenmiş ve 80 V, 25 ma de yaklaşık 60 dakika süreyle elektroforeze tabi tutulmuştur. Beklenen moleküler ağırlıkta oluşan tek bir DNA bantı temiz bir bistüri yardımı ile dikkatli bir şekilde kesilerek alınmış ve darası alınan temiz bir mikrosantrifüj tüpüne konarak miktarı tespit edilmiştir. DNA, Ek 2.7. de verilen protokle göre agaroz jelden arındırılmıştır. Saflaştırılan DNA dan 5 μl si alınarak spektrofotometrede (OD 260 nm de) okunarak miktarı ve saflık derecesi belirlenmiştir. Daha sonra DNA ligasyonda kullanılmak üzere +4 ºC de saklanmıştır Sıcaklığa Dirençli β-amilaz Geninin pbluescript II KS/SK Klonlama Vektörü ile E. coli de Klonlanması (1). pbluescript II KS/SK Klonlama Vektörünün İzolasyonu ve Ligasyona Hazırlanması E. coli den pbluescript II KS/SK plazmid DNA sı Birnboim ve Doly (1979) a göre izole edilmiştir. İlgili protokol Ek 2.8. de verilmiştir. İzolasyonu yapılan pbluescript II KS/SK plazmid DNA sı Ek 2.2. de verilen protokole göre RNaz enzimi ile muamele edilerek RNA dan arındırılmıştır (2). pbluescript II KS/SK Klonlama Vektörünün Sma I Endonüklazı ile Kesimi İzolasyonu yapılan ve RNaz enzimi muamele edilerek RNA dan arındırılan pbluescript II KS/SK plazmid DNA sı Sma I endonükleaz enzimi ile kesilerek düz 44

62 3. MATERYAL VE METOD Bahri Devrim ÖZCAN zincir (doğrusal) haline getirilmiştir. Sma I endonükleazı genom üzerinde 5'- CCCGGG-3' dizilerini tanıyan ve 3. pozisyondaki C ile 4. pozisyondaki G bazları arasından DNA yı keserek küt uç oluşturan bir enzimdir. pbluescript II KS/SK plazmid DNA sının Sma I endonükleazı ile kesim reaksiyonu bileşenleri Çizelge 3.4. de verilmiştir. Çizelge 3.4. pbluescript II KS/SK vektörünün Sma I endonükleazı ile kesim reaksiyonu bileşenleri Cinsi Stok Konsantrasyon Alınan Miktar Son Konsantrasyon pbluescript 1200 ng/μl 5 μl 6000 ng Reaksiyon 10 X 4 μl 1 X tamponu Sma I enzimi 10 U/μl 1 μl 10 U Deionize su - 30 μl - TOPLAM - 40 μl - Kesim reaksiyonu 37 ºC de yaklaşık 90 dakika inkübe edildikten sonra 5 μl si alınarak DNA markırı ile %0.8 lik agaroz jelde incelenmiştir. Geriye kalan vektör DNA fenol-kloroform uygulaması ile saflaştırılıp Na-asetat/etanol uygulaması ile çöktürülmüş ve elde edilen DNA peleti 15 μl TE solüsyonu (Ek 1.14.) ile çözülmüştür. DNA tamamen çözüldükten sonra spektrofotometrede miktarı ve saflığı ölçülerek +4 ºC ye kaldırılmıştır (3). Sıcaklığa Dirençli β-amilaz Geni ile pbluescript II KS/SK DNA sının Ligasyonu Yukarıdaki uygulamalar ile ligasyona hazır hale getirilen sıcaklığa dirençli β- amilaz geni ile pbluescript II KS/SK plazmid DNA sı için hazırlanan ligasyon reaksiyonu bileşenleri Çizelge 3.5. de verilmiştir. İki DNA nın birbirine ligasyonu ise şematik olarak Şekil 3.8. de verilmiştir. 45

63 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Çizelge 3.5. Sıcaklığa dirençli β-amilaz geni ile pbluescript II KS/SK vektörü için hazırlanan ligasyon reaksiyonu bileşenleri Cinsi Stok Konsantrasyonu Alınan Miktar Son Konsantrasyon β-amilaz 2000 ng/μl 0.8 μl 1600 ng pbluescript / Sma I 2700 ng/μl 0.2 μl 540 ng Ligaz Tamponu 10 X 2 μl 1 X T4 DNA Ligaz 5 U/μl 0.5 μl 2.5 U PEG %50 w/v 2 μl %5 w/v Deionize Su μl - TOPLAM - 20 μl - Elde edilen ligasyon reaksiyonu 22 ºC de 60 dakika inkübe edilmiştir. Daha sonra ligasyon sıvısı 65 ºC de 10 dakika tutularak enzim denatüre edilmiştir. Son olarak ligasyon karışımı E. coli XL1 Blue MRF' bakterisine transferde kullanılmıştır. Şekil 3.8. β-amilaz geninin pbluescript II KS/SK vektörüne ligasyonunun şematik modeli (4). Kompetent Bakteri Hazırlama ve Transformasyon Kompetent bakteri oluşturmada kullanılan E. coli XL1 Blue MRF' suşu, doğal olarak herhangi bir plazmid bulundurmayan fakat kromozomal DNA sı üzerinde tetrasiklin direnç geni (tet R ) taşıyan bir suştur. Ek 2.9. da verilen protokol uygulanarak bakteri kompetent hale getirilmiş ve ligasyon reaksiyonu sıvısından belli bir miktar alınarak Ek da verilen protokole göre transfer yapılmıştır. 46

64 3. MATERYAL VE METOD Bahri Devrim ÖZCAN (5). β-amilaz Geni Taşıyan Rekombinant Bakterilerin Belirlenmesi Transformasyon tüpündeki sıvıların tamamı önce ayrı ayrı 1 ml LB sıvı besiyerlerine (antibiyotik içermiyor) boşaltılarak 37 ºC de 1 saat süreyle üretilmişlerdir. Bu uygulama ile, kompetent hale getirme işlemleriyle hassaslaşmış olan bakterilerin normal hale dönmeleri ve plazmid DNA ile taşınan antibiyotiğe direnç geninin azda olsa eksprese olarak, bakterinin bir saat sonra ekileceği antibiyotikli besiyerine adaptasyonu sağlanmış olacaktır. Bir saat sonra bakteriler alınarak μl hacimler halinde LB/Agar/Amp/X-gal plaklarına (50 μg/ml amfisilin, 40 μg/ml X-gal (Ek 1.15.)) steril cam çubukla yayma yöntemiyle ekilmiş ve plaklar 5-10 dakika kurutulduktan sonra ters çevrilerek 37 ºC ye ayarlanmış inkübatöre ertesi güne kadar üremeye bırakılmıştır. Ertesi gün transformasyon plaklarında rekombinant (geni almış olan) ve non-rekombinant (geni almadan kapanmış olan) plazmid DNA lar ile transforme olmuş olan bakteriler üreyecektir. Hem rekombinant hem de non-rekombinant bakterilerde amfisilin direnç geni (βlaktamazı kodlar) sağlam olacağı için koloni oluşturabileceklerdir. Rekombinant bakterilerde β-amilaz geni pbluescript II KS/SK plazmidi üzerindeki LacZ geni içerisinde bulunan çoklu klonlama bölgesine (MCS) takıldığı için LacZ geni inaktive olacaktır. Dolayısıyla rekombinant bakteriler ortamdaki X-gal i parçalayamayacağından koloniler beyaz renkli olarak gelişecektir. Diğer taraftan rekombinant olmayan plazmidleri alan rekombinant bakterilerin LacZ geni sağlam olacağından besiyerindeki X-gal i kullanacak ve koloniler mavi olarak gelişecektir. Ertesi gün transformasyon plağında gelişen beyaz renkli rekombinant kolonilerin her biri ayrı bir steril kürdanla alınarak amfisilin içeren 2 adet LB/Agar/Amp plağına iki kopya olacak şekilde aktarılmış ve tekrar 37 ºC ye ayarlanmış inkübatörde üremeye bırakılmıştır. Ertesi gün plaklardan 1 tanesi 60 ºC ye kaldırılmış, diğeri ise tekrar 37 ºC de bırakılarak 4 saat daha inkübasyona devam edilmiştir. Bu şekilde 60 ºC ye kaldırılmış plaktaki bakteriler tarafından besi ortamına sentezlenen sıcaklığa dirençli β-amilaz enziminin aktifleşerek ortamdaki nişastayı parçalaması amaçlanmıştır. Süre sonunda 60 ºC de inkübe edilen plak iyot 47

65 3. MATERYAL VE METOD Bahri Devrim ÖZCAN buharı ile boyanarak etrafında açık zon olan β-amilaz pozitif koloniler tespit edilmiştir (6). β-amilaz Pozitif Kolonilerden İzole Edilen Rekombinant Vektörlerin İnsört ve PCR Analizleri Elde edilen rekombinant bakteriler ile 1 adet β-amilaz negatif (-) kontrol bakterisinden Ek 2.8. de verilen protokole göre plazmid DNA izole edilerek Ek 2.2. de verilen protokole göre de RNA dan arındırılmıştır. β-amilaz geninin PCR dan amplifikasyonu için hazırlanan primerlerin uç bölgelerine Bam HI kesim noktaları yerleştirilmesinden dolayı, geni tekrar çıkarmak için vektörler Bam HI enzimi ile kesilmiştir. Kontrol kolonisinden izole edilen plazmid vektörü de yine aynı enzimle kesilmiştir. Kesim reaksiyonunun her birinden 10 ar μl alınarak %0.8 lik agaroz jelde elektroforeze tabi tutulmuştur. Plazmidi rekombinant halde düz zincir (doğrusal) hale getirmek için de β- amilaz geni içerisinde kesim noktası bulunmayan, fakat pbluescript II KS/SK DNA sını tek bir noktadan kesen Eco RI enzimi ile kesim reaksiyonu hazırlanmıştır. Yine orijinal plazmid de (pbluescript II KS/SK) Bam HI enzimi ile tek noktadan kesilerek düz bir zincir haline getirilmiştir. Ayrıca hem T. thermosulfurogenes kromozomal DNA sı hem de rekombinant pbluescriptβ plazmid DNA sı kalıp olarak kullanılmış ve ayrı ayrı PCR reaksiyonu hazırlanmıştır. Son olarak elde edilen PCR ürünü DNA lar için, β-amilaz genini tek noktadan kesen Hind III enzimi ile kesim reaksiyonu hazırlanmıştır. Elde edilen kesim ve PCR ürünleri %0.8 lik agaroz jelde elektroforeze tabi tutulmuştur. Elde edilen jel görüntüsü UVitec jel görüntüleme cihazı ile fotoğraflanmıştır Sıcaklığa Dirençli β-amilaz Geninin pub110 Klonlama Vektörü ile B. subtilis BR151 ve B. amyloliquefaciens de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geninin pub110 a Ligasyonu pbluescriptβ vektöründen Bam HI enzimi ile kesilerek çıkarılan β-amilaz geni ile yine Bam HI enzimi ile kesilmiş olan pub110 vektörünün ligasyon reaksiyonu hazırlanmıştır (Çizelge 3.6.). 48

66 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Çizelge 3.6. β-amilaz geni ile pub110 vektörünün ligasyon reaksiyonu bileşenleri Cinsi Stok Konsantrasyonu Alınan Miktar Son Konsantrasyon β-amilaz / Bam HI 350 ng/μl 1 μl 350 ng pub110 / Bam HI 300 ng/μl 2 μl 600 ng Reaksiyon tamponu 10 X 2 μl 1 X T4 DNA ligaz 5 U/μl 0.5 μl 2.5 U Deionize su μl - TOPLAM - 20 μl - Hazırlanan ligasyon reaksiyonu 22 ºC de 60 dakika inkübe edildikten sonra fenol/kloroform ve kloroform uygulamaları ile enzimden arındırılmıştır. Son olarak ligasyon karışımından bir miktar alınarak B. subtilis BR151 ve B. amyloliquefaciens bakterilerinin elektrotransformasyonunda kullanılmıştır. Yeni oluşturulan pub110β nın şematik modeli Şekil 3.9. da verilmiştir. Şekil 3.9. pub110β nın oluşturulmasının şematik modeli (2). pub110β Rekombinant Vektörün B. subtilis BR151 Bakterisine Elektrotransformasyonu Çizelge 3.6. da verilen ligasyon karışımı Ek de verilen protokole göre (Xue ve ark., 1999) B. subtilis BR151 bakterisine transfer edilmiştir. 49

67 3. MATERYAL VE METOD Bahri Devrim ÖZCAN (3). pub110β Rekombinant Vektörün B. amyloliquefaciens Bakterisine Elektrotransformasyonu Çizelge 3.6. da verilen ligasyon karışımı Ek de verilen protokole göre (Vehmaanperä, 1989) B. amyloliquefaciens bakterisine transfer edilmiştir (4). Koloni Seçimi ve Rekombinantların Karakterizasyonu Ertesi gün gerek B. subtilis BR151 gerekse B. amyloliquefaciens transformasyon plaklarında gelişen rekombinant kolonilerin her biri ayrı bir steril kürdanla alınarak 3 adet LB/Agar/Kan (20 μg/ml kanamisin) plağına üç kopya olacak şekilde aktarılmış ve tekrar 37 ºC ye ayarlanmış inkübatörde üremeye bırakılmıştır. Ertesi gün plaklardan 1 er tanesi 60 ºC ye kaldırılmış, diğer ikişer tanesi ise 37 ºC de bırakılarak 4 saat daha inkübasyona devam edilmiştir. Bu şekilde 60 ºC ye kaldırılmış plaklardaki bakteriler tarafından besi ortamına salgılanan sıcaklığa dirençli β-amilaz enziminin aktifleşerek ortamdaki nişastayı parçalaması amaçlanmıştır. Süre sonunda 37 ºC de inkübe edilen plaklardan bir tanesi ile 60 ºC de inkübe edilen plak iyot buharı ile boyanmıştır (5). B.subtilis BR151/pUB110β ve B.amyloliquefaciens/pUB110β ya İlişkin Plak Testleri B. subtilis BR151/pUB110β ve B. amyloliquefaciens/pub110β bakterileri orijinal bakteriler (B. subtilis BR151 ve B. amyloliquefaciens) ile beraber plak testi için 2 adet LB/Nişasta/Agar/Kan ve 2 adet LB/Nişasta/Agar plağına steril kürdan yardımı ile ekilmiş ve plaklar ters çevrilerek 37 ºC de bir gece inkübasyona bırakılmışlardır. Gerek LB/Nişasta/Agar gerekse LB/Nişasta/Agar/Kan plaklarından birer tanesi 60 ºC ye ayarlanmış inkübatöre kaldırılmış ve inkübasyona yaklaşık 4 saat daha devam edilmiştir. Diğer plakların ise aynı süre boyunca 37 ºC de inkübasyonuna devam edilmiştir. Süre sonunda plaklar inkübatörlerden çıkarılarak kapaklarına birkaç parça iyot kristali ezilmiş ve açığa çıkan iyot buharının nişastalı plakları boyaması sağlanmıştır. 50

68 3. MATERYAL VE METOD Bahri Devrim ÖZCAN (6). Rekombinant pub110β ya İlişkin Kesim ve PCR Analizleri Gerek B. amyloliquefaciens/pub110β gerekse B. subtilis BR151/pUB110β bakterilerinden Ek.2.1. de verilen protokole göre rekombinant pub110β vektörleri izole edilerek Ek 2.2. de verilen protokole göre de RNA dan arındırılmışlardır. Sıcaklığa dirençli β-amilaz geninin pub110 vektörüne entegrasyonu Bam HI enzimi ile yapıldığından geni çıkartmak için rekombinant pub110β plazmidi bu enzimle tekrar kesilmiştir. Yine orijinal plazmid de (pub110) Bam HI enzimi ile kesilerek doğrusal hale getirilmiştir. Kesim reaksiyonu ürünlerinden bir miktar alınarak %0.8 lik agaroz jelde incelenmiştir. Ayrıca B. amyloliquefaciens/pub110β ve B. subtilis BR151/pUB110β bakterilerinden izole edilen pub110β rekombinant vektörleri kalıp DNA olarak kullanılmış ve β-amilaz geni PCR da sentezlenmiştir. Reaksiyon sonlandıktan sonra PCR ürününden bir miktar alınarak, klonlanan DNA parçasının β-amilaz geni olduğunu anlamak amacıyla, geni tek noktadan kesen Hind III enzimi ile kesim reaksiyonu hazırlanmıştır. Elde edilen kesim ve PCR ürünleri %0.8 lik agaroz jelde elektroforeze tabi tutulmuştur. Elde edilen jel görüntüsü UVitec jel görüntüleme cihazı ile fotoğraflanmıştır (7). Sıcaklık Uygulaması ile Mezofilik Kökenli Proteinlerin Denatüre Edilerek Sıcaklığa Dirençli β-amilazın SDS-Nişasta- PAGE de Gösterilmesi Rekombinant B. subtilis BR151/pUB110β ve B. amyloliquefaciens/pub110β ile orijinal B. subtilis BR151 ve B. amyloliquefaciens bakterilerine ait hücredışı proteinler 85 ºC de 15 dakika süreyle sıcaklığa maruz bırakılarak Bacillus kökenli proteinler denatüre edilmiş ve ortamda sıcaklığa dirençli β-amilazın aktif olarak kalması sağlanmıştır. İlgili Protokol Ek de verilmiştir. Elde edilen örnekler Ek 2.5. de verilen protokole göre SDS-Nişasta-PAGE de elektroforeze tabi tutulmuştur. 51

69 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Sıcaklığa Dirençli β-amilaz Geninin pl2 Klonlama Vektörü ile E. coli de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geni ile pl2 Vektörünün Ligasyonu pl2 rekombinant vektörü Ç.Ü. Ziraat Fakültesi Zootekni Bölümü Hayvansal Biyoteknoloji ve Genetik Mühendisliği Laboratuarı nda ptrw10 vektöründen modifiye edilerek geliştirilmiştir (Aşan ve ark., 2005). Plazmid DNA pbluescript II KS/SK orijinli olup bakteriyofaj T4 lizozim geni ile E. coli / Streptococcus mekik vektörü olan ptrw10 un replikasyon orijini bölgesini taşımaktadır (Şekil 3.10.). Şekil pl2 rekombinant vektörünün yapısı (Aşan ve ark., 2005) pl2 plazmid DNA sı Bam HI enzimi ile kesilerek lizozim geni çıkarılmış, geriye kalan pbluescript II KS/SK + ptrw10 R.O. kısmı ise (pbt10) Ek 2.7. de verilen protokole göre agaroz jelden saflaştırılmıştır. Jelden saflaştırılan pbt10 plazmid DNA sı ile pbluescriptβ vektöründen Bam HI enzimi ile kesilerek çıkarılan β-amilaz geni için ligasyon reaksiyonu hazırlanmıştır (Çizelge 3.7.). Çizelge 3.7. β-amilaz geni ile pbt10 vektörünün ligasyon reaksiyonu bileşenleri Cinsi Stok Konsantrasyon Alınan Miktar Son Konsantrasyon β-amilaz / Bam HI 350 ng/μl 1 μl 350 ng pbt10 / Bam HI 650 ng/μl 2 μl 1300 ng Reaksiyon tamponu 10 X 2 μl 1 X T4 DNA ligaz 5 U/μl 0.5 μl 2.5 U Deionize su μl - TOPLAM - 20 μl - 52

70 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Elde edilen ligasyon reaksiyonu 22 ºC de 60 dakika inkübe edildikten sonra 65 ºC de 10 dakika tutularak enzim denatüre edilmiştir. Son olarak ligasyon karışımından bir miktar alınarak E. coli XL1 Blue MRF' bakterisine transferde kullanılmıştır. Yeni oluşturulan pbt10β nın şematik modeli Şekil de verilmiştir. Şekil pbt10β nın şematik modeli (2). β-amilaz Geni Taşıyan Rekombinant Plazmidin (pbt10β) E. coli XL1 Blue MRF' Bakterisine Transferi Çizelge 3.7. de verilen ligasyon karışımından 6 μl alınarak Ek 2.9. ve Ek da verilen protokollere göre E. coli XL1 Blue MRF' bakterisine transfer edilmiştir (3). Rekombinant E. coli Kolonilerinin Seçimi ve Karakterizasyonu Transformasyon plağında gelişen kolonilerden 4 tanesi steril kürdan yardımı ile LB/Agar/Amp plaklarına ekilerek 37 ºC de gece boyunca inkübasyona bırakılmıştır. Ertesi gün plaklardan 1 tanesi 60 ºC ye alınırken diğeri 37 ºC de bırakılmış ve 4 saat daha inkübasyona devam edilmiştir. İnkübasyon sonunda plaklar iyot buharı ile boyanarak β-amilaz pozitif koloniler tespit edilmiştir. β-amilaz pozitif kolonilerden bir tanesi seçilerek Ek 2.8. de verilen protokole göre plazmid DNA 53

71 3. MATERYAL VE METOD Bahri Devrim ÖZCAN izolasyonu yapılmıştır. Daha sonra izole edilen DNA Ek 2.2. de verilen protokole göre RNA dan arındırılmıştır. Son olarak rekombinant DNA nın (pbt10β) spektrofotometrede miktarı ve saflığı ölçülerek +4 ºC de muhafaza edilmiştir (4). pbt10β dan β-amilaz Geninin PCR ile Sentezlenmesi pbt10β rekombinant vektörü kalıp DNA olarak kullanılmış ve β-amilaz geninin sentezi için PCR reaksiyonu hazırlanmıştır. Reaksiyon sonlandıktan sonra PCR ürününden bir miktar alınarak, klonlanan DNA parçasının β-amilaz geni olduğunu anlamak amacıyla tek noktadan kesen Hind III enzimi ile kesim reaksiyonu hazırlanmıştır. Elde edilen kesim ve PCR ürünleri %0.8 lik agaroz jelde elektroforeze tabi tutulmuştur. Elde edilen jel görüntüsü UVitec jel görüntüleme cihazı ile fotoğraflanmıştır Sıcaklığa Dirençli β-amilaz Geninin pnw33n Klonlama Vektörü ile E. coli de Klonlanması (1). β-amilaz Geninin pnw33n Vektörü ile Ligasyona Hazırlanması E. coli/b. subtilis/b. stearothermophilus mekik vektörü olan pnw33n mekik DNA sı Bam HI enzimi ile kesilerek düz zincir haline getirilmiştir. Daha sonra alkalin fosfataz (CIAP) enzimi ile muamele edilerek 5' ucundaki fosfat grupları uzaklaştırılmıştır. pnw33n DNA sının kesim ve alkalin fosfataz reaksiyonu bileşenleri sırasıyla Çizelge 3.8. ve Çizelge 3.9. da verilmiştir. Çizelge 3.8. pnw33n vektörünün Bam HI enzimi ile kesim reaksiyonu bileşenleri Cinsi Stok Konsantrasyonu Alınan Miktar Son Konsantrasyon pnw33n 2200 ng/μl 3 μl 6600 ng Reaksiyon 10 X 4 μl 1 X tamponu Bam HI 10 U/μl 1 μl 10 U Deionize su - 32 μl - TOPLAM - 40 μl - 54

72 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Çizelge 3.9. pnw33n vektörünün alkalin fosfataz reaksiyonu bileşenleri Cinsi Stok Konsantrasyonu Alınan Miktar Son Konsantrasyon pnw33n / Bam HI 560 ng/μl 20 μl 11.2 μg (9 pmol uç) Reaksiyon tamponu 10 X 5 μl 1 X Alkalin fosfataz(ciap) 1 U/μl 0.5 μl 0.5 U Deionize su μl - TOPLAM - 20 μl - Elde edilen reaksiyon karışımı 37 ºC de 1 saat inkübe edildikten sonra 85 ºC de 15 dakika tutularak enzim denatüre edilmiştir. Kesim reaksiyonu 37 ºC de yaklaşık 90 dakika inkübe edildikten sonra 5 μl si alınarak DNA markırı ile %0.8 lik agaroz jelde incelenmiştir. Geriye kalan vektör DNA fenol-kloroform uygulaması ile saflaştırılıp Na-asetat/etanol uygulaması ile çöktürülmüş ve elde edilen DNA peleti 15 μl TE solüsyonu ile çözülmüştür. DNA tamamen çözüldükten sonra spektrofotometrede miktarı ve saflığı ölçülerek +4 ºC ye kaldırılmıştır (2). pnw33n Vektörü ile β-amilaz Geninin Ligasyonu Bam HI enzimi ile kesilerek alkalin fosfataz uygulaması ile 5' ucundaki fosfat grupları uzaklaştırılan pnw33n plazmid DNA sı ile β-amilaz geni için ligasyon reaksiyonu hazırlanmıştır. Ligasyon reaksiyonu bileşenleri Çizelge da verilmiştir. Çizelge β-amilaz geni ile pnw33n vektörünün ligasyon reaksiyonu bileşenleri Cinsi Stok Konsantrasyonu Alınan Miktar Son Konsantrasyon β-amilaz / Bam HI 100 ng/μl 2 μl 200 ng pnw33n / Bam HI / 225 ng/μl 2 μl 450 ng CIAP Reaksiyon tamponu 10 X 2 μl 1 X T4 DNA ligaz 5 U/μl 0.5 μl 2.5 U Deionize su μl - TOPLAM - 20 μl - 55

73 3. MATERYAL VE METOD Bahri Devrim ÖZCAN Elde edilen ligasyon reaksiyonu 22 ºC de 60 dakika inkübe edilmiştir. Daha sonra ligasyon sıvısı 65 ºC de 10 dakika tutularak enzim denatüre edilmiştir. Son olarak ligasyon karışımından bir miktar alınarak E. coli XL1 Blue MRF' bakterisine transferde kullanılmıştır. Yeni oluşturulan pnw33nβ nın şematik modeli Şekil de verilmiştir. Şekil pnw33nβ nın oluşturulmasının şematik modeli (3). β-amilaz Geni Taşıyan Rekombinant pnw33nβ Vektörünün E. coli XL1 Blue MRF' Bakterisine Transferi Çizelge da verilen ligasyon karışımından 6 μl alınarak Ek 2.9. ve Ek da verilen protokollere göre E. coli XL1 Blue MRF' bakterisine transfer edilmiştir (4). Koloni Seçimi ve Rekombinantların Karakterizasyonu Transformasyon plağında gelişen kolonilerden 10 tanesi steril kürdan yardımı ile LB/Agar/Cml (25 μg/ml kloramfenikol) plaklarına ekilerek 37 ºC de gece boyunca inkübasyona bırakılmıştır. Ertesi gün plaklardan 1 tanesi 60 ºC ye alınırken diğeri 37 ºC de bırakılmış ve 4 saat daha inkübasyona devam edilmiştir. İnkübasyon sonunda plaklar iyot buharı ile boyanarak β-amilaz pozitif koloniler tespit edilmiştir. β-amilaz pozitif kolonilerden bir tanesi seçilerek Ek 2.8. de verilen protokole göre plazmid DNA izolasyonu yapılmıştır. Daha sonra izole edilen DNA Ek 2.2. de verilen protokole göre RNA dan arındırılmıştır. Son olarak rekombinant DNA nın 56

74 3. MATERYAL VE METOD Bahri Devrim ÖZCAN (pnw33nβ) spektrofotometrede miktarı ve saflığı ölçülerek +4 ºC de muhafaza edilmiştir (5). β-amilaz Pozitif Koloniden İzole Edilen Rekombinant Vektörün İnsört ve PCR Analizleri Rekombinant pnw33nβ vektöründen β-amilaz genini çıkarmak için Bam HI enzimi ile kesilmiştir. Yine orijinal plazmid de (pnw33nβ) Bam HI enzimi ile tek noktadan kesilerek düz bir zincir haline getirilmiştir. Ayrıca hem T. thermosulfurogenes kromozomal DNA sı hem de rekombinant pnw33nβ plazmid DNA sı kalıp olarak kullanılmış ve ayrı ayrı PCR reaksiyonu hazırlanmıştır. Elde edilen kesim ve PCR ürünleri DNA markırla beraber %0.8 lik agaroz jelde elektroforeze tabi tutulmuştur. Elde edilen jel görüntüsü UVitec jel görüntüleme cihazı ile fotoğraflanmıştır Sıcaklığa Dirençli β-amilaz Geni Taşıyan Rekombinant Bakterilere İlişkin SDS-PAGE ve Zymogram Analizleri (1). Bakterilerden Proteinlerin İzolasyonu E. coli/pbluescriptβ bakterisinden hem hücreiçi (intraselülar) hem de hücredışı (ekstraselülar) protein izolasyonu gerçekleştirilmiştir. İntraselülar protein izolasyonu için, 48 saat süreyle üretilmiş E. coli/pbluescriptβ bakterileri 4500 rpm de 10 dakika süreyle santrifüjle çöktürülmüş ve elde edilen bakteri peleti başlangıç hacmine eşit saf su ile çözülmüştür. Elde edilen bakteri çözeltisi buz içerisinde 1 dakika süreyle sonikasyon işlemine tabi tutularak (50-60 khz) hücreler patlatılmış, açığa çıkan hücresel atıklar ise 4500 rpm de santrifüjle uzaklaştırılmıştır. Son olarak hücreiçi proteinleri içeren süpernatant kısım Ek 2.4 de verilen protokole göre TCA ile muamele edilerek proteinler elde edilmiştir. E. coli/pbluescriptβ ile diğer bakterilere (B. subtilis BR151/pUB110β, B. amyloliquefaciens/pub110β, T. thermosulfurogenes) ait hücredışı proteinler ise yine Ek 2.4. de verilen protokole göre TCA ile muamele edilerek elde edilmiştir. Son olarak protein örnekleri üzerine hacmin yarısı kadar kaynatma solüsyonu (Ek. 1.6.) ilave edilerek SDS-PAGE de elektroforez için hazır hale getirilmiştir. 57

75 3. MATERYAL VE METOD Bahri Devrim ÖZCAN (2). Bakterilere Ait Toplam Proteinlerin SDS-PAGE de Karşılaştırılması Protein örnekleri %12 lik SDS-PAGE jele yüklenerek uygun volt ve ma değerlerinde proteinlerin jel içerisinde birbirinden ayrılması sağlanmıştır. Proteinlerin jel içerisinde ilerlemesi tamamlandıktan sonra, jel dikkatli bir şekilde iki cam levha arasından çıkarılarak içerisinde boya solüsyonu (Coomassie blue) (Ek 1.8.) bulunan bir kabın içerisine konmuş ve dk süreyle jelin boyanması için beklenmiştir. Boyama tamamlandıktan sonra jel boyadan alınmış ve içerisinde destain solüsyonu (yıkama solüsyonu) (Ek 1.9.) bulunan bir kaba konarak fazla boyanın uzaklaşması sağlanmıştır. Son olarak bakterilere ait toplam hücredışı proteinler karşılaştırılmıştır (3). Bakteriyel Proteinlerin SDS-Nişasta-PAGE de Karşılaştırılması Protein örnekleri %12 lik SDS-Nişasta-PAGE (%0.2 w/v nişasta) jele yüklenerek proteinlerin jel içerisinde ilerlemesi sağlanmıştır. Proteinlerin jel içerisinde ilerlemesi tamamlandıktan sonra jel Ek 2.5. de verilen protokole göre muamele edilerek β-amilaz enziminden sorumlu bant ortaya çıkarılmıştır. Fakat bu protokolde Ek 2.5. den farklı olarak 50 mm Na-fosfat solüsyonu (ph 7.2) yerine β- amilazın optimum çalışma ph sına uyumlu olan 100 mm Na-asetat solüsyonu (ph 5.5) kullanılmıştır. Diğer işlemlerde Ek 2.5. de verilen protokole aynen uyulmuştur. 58

76 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN 4. BULGULAR VE TARTIŞMA 4.1. Bulgular Sıcaklığa Dirençli α-amilaz Geninin Klonlanmasına Yönelik Bulgular Sıcaklığa Dirençli α-amilaz Geninin B. subtilis Suşlarına Elektroporasyon Tekniği ile Aktarılması Bacillus stearothermophilus a ait sıcaklığa dirençli α-amilaz geni taşıyan rekombinant pc194α plazmid DNA sı Bacillus subtilis ATCC31786/pC194α (αamilaz +, CMCaz +, ksilanaz +, likenaz + ) bakterisi içerisinde Bacillus Genetic Stock Center dan temin edilmiştir. pc194α plazmidi B. subtilis ATCC31786/pC194α dan izole edilerek B. subtilis YB886 (α-amilaz -, CMCaz +, ksilanaz +, likenaz + ) ve B. subtilis BR151 (α-amilaz -, CMCaz +, ksilanaz +, likenaz + ) suşlarına elektroporasyon tekniği ile aktarılmıştır. Elektroporasyon sonrasında sıcaklığa dirençli α-amilaz enzimini üreten B. subtilis YB886/pC194α (α-amilaz +, CMCaz +, ksilanaz +, likenaz + ) ve B. subtilis BR151/pC194α (α-amilaz +, CMCaz +, ksilanaz +, likenaz + ) suşları geliştirilmiştir (1). Rekombinant Kolonilerin Selektif Besiyerlerinde Fenotipik Testleri Rekombinant B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterileri ile orijinal B. subtilis YB886 ve B. subtilis BR151 bakterileri karşılaştırmalı fenotipik test için, farklı substratlar (nişasta, CMC, ksilan ve likenan) içeren antibiyotikli (50 μg/ml kloramfenikol) ve antibiyotiksiz LB/Agar plaklarında karşılaştırılmış ve LB/Agar plaklarında hem rekombinant hem de orijinal bakterilerin gelişerek koloni oluşturdukları gözlenmiştir (Şekil 4.1.). Antibiyotik içeren LB/Agar/Cml plaklarında ise, pc194α vektörü üzerindeki kloramfenikol dirençlilik geni (Cml R ) sayesinde rekombinant bakterilerin gelişerek koloni oluşturduğu, buna karşılık bu geni taşımayan orijinal bakterilerin ise antibiyotikli ortamda koloni oluşturamadıkları gözlenmiştir (Şekil 4.2.). 59

77 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil 4.1. Orijinal bakteriler ile B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerinin antibiyotik içermeyen test plaklarında karşılaştırılması: A: LB/Nişasta/Agar, B: LB/CMC/Agar, C: LB/Ksilan/Agar, D: LB/Likenan/Agar (Amy: pc194α plazmidi almış rekombinant B. subtilis kolonileri) Şekil 4.2. Orijinal bakteriler ile B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerinin kloramfenikol içeren test plaklarında karşılaştırılması: A: LB/Nişasta/Agar/Cml, B: LB/CMC/Agar/Cml, C: LB/Ksilan/Agar/Cml, D: LB/Likenan/Agar/Cml (Amy: pc194α plazmidi almış rekombinant B. subtilis kolonileri) Daha sonra plaklar içerdiği substrata (enzim hedef maddesi) özgü boya ile boyanarak (nişasta içeren plaklar iyot buharı ile, CMC, ksilan ve likenan içeren 60

78 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN plaklar ise Congo-red boyası ile) fenotipik testleri yapılmıştır. Boyama sonucunda, orijinal B. subtilis YB886 ve B. subtilis BR151 bakterilerinin CMCaz, ksilanaz ve likenaz pozitif (CMCaz +, ksilanaz +, likenaz + ) fakat α-amilaz negatif (α-amilaz - ) olduğu belirlenmiştir. pc194α rekombinant vektörünü alarak rekombinant hale geçen B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerinin, diğer enzim aktivitelerine ilaveten transfer edilen pc194α vektörüne bağlı olarak α-amilaz aktivitesi de kazandığı (α-amilaz +, CMCaz +, ksilanaz +, likenaz + ) gözlenmiştir (Şekil 4.3.). Şekil 4.3. Test plaklarının boyanması ile rekombinant ve orijinal bakterilerin enzimatik aktivitelerinin karşılaştırılması: A: LB/Nişasta/Agar, B: LB/CMC/Agar, C: LB/Ksilan/Agar, D: LB/Likenan/Agar (1a: YB886, 1b: YB886/pC194α, 2a: BR151, 2b: BR151/pC194α) (2). B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α dan Rekombinant pc194α Vektörünün İzole Edilerek Kesim Analizi B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α dan rekombinant pc194α plazmid DNA sı izole edilerek, gen entegrasyonu Hind III enzimi ile yapıldığı için bu enzimle kesilmiştir. Kesim reaksiyonu %0.8 lik agaroz jelde incelendiğinde yaklaşık 2.9 kbç büyüklüğünde pc194 plazmid DNA sı ile 5.2 kbç büyüklüğündeki α-amilaz geni bantları (α) gözlenmiştir (Şekil 4.4.). 61

79 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil 4.4. Rekombinant B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerden izole edilen pc194α vektörlerin Hind III enzimi ile kesim analizi: M: markır, 1: pc194α (kesilmemiş), 2: pc194α/hind III (ATCC31786/pC194α dan izole), 3: pc194α/hind III (YB886/pC194α dan izole), 4: pc194α/hind III (BR151/pC194α dan izole) (3). Rekombinant ve Orijinal Bakterilere Ait Toplam Proteinlerin SDS-PAGE de Karşılaştırılması B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterileri ile orijinal bakterilere ait toplam proteinler SDS-PAGE de karşılaştırılmıştır. SDS- PAGE de toplam protein bantları incelendiğinde rekombinant suşlar ile orijinal suşların bant profillerinde önemli bir değişiklik olmadığı gözlenmiştir (Şekil 4.5.). Bunun muhtemel nedeni olarak sıcaklığa dirençli α-amilaz enzimi ile aynı moleküler büyüklüğe sahip diğer hücre proteinlerinin jelde aynı lokasyonları işgal etmeleri gösterilebilir. Bu nedenle SDS-Nişasta-PAGE de aktiviteler incelenmiştir. 62

80 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil 4.5. Rekombinant ve orijinal bakterilere ait toplam proteinlerin SDS-PAGE de karşılaştırılması: M: markır, 1: B. stearothermophilus ATCC12980, 2: B. subtilis ATCC31786/pC194α, 3: B. subtilis YB886, 4: B. subtilis YB886/pC194α, 5: B. subtilis BR151, 6: B. subtilis BR151/pC194α (4). Rekombinant ve Orijinal Bakterilere Ait Toplam Proteinlerin SDS-Nişasta-PAGE de Karşılaştırılması Sıcaklığa dirençli α-amilaz enziminden sorumlu bandın tespit edilebilmesi için, B. subtilis YB886/pC194α ve BR151/pC194α bakterileri ile orijinal bakterilere ait toplam proteinler %12 lik SDS-Nişasta-PAGE de karşılaştırılmıştır. Jelin iyot boyası ile boyanmasından sonra, daha önce α-amilaz aktivitesine sahip olmayan B. subtilis YB886 ve B. subtilis BR151 suşlarının, pc194α plazmidinin elektrotransformasyonla aktarılmasından sonra α-amilaz aktivitesi kazandıkları ve rekombinant B. subtilis ATCC31786/pC194α suşuna ait α-amilaz enzim bantı ile aynı moleküler ağırlıkta bantlar oluşturdukları gözlenmiştir (Şekil 4.6.). 63

81 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil 4.6. Rekombinant ve orijinal bakterilerin α-amilaz aktivitelerinin SDS-Nişasta- PAGE de karşılaştırılması: 1: B. subtilis ATCC31786/pC194α, 2: B. subtilis YB886, 3: B. subtilis YB886/pC194α, 4: B. subtilis BR151, 5: B. subtilis BR151/pC194α (5). Sıcaklık Uygulaması ile Mezofilik Kökenli Proteinlerin Denatüre Edilerek Sıcaklığa Dirençli α-amilazın SDS-Nişasta- PAGE de Gösterilmesi B. subtilis YB886/pC194α ve B. subtilis BR151/pC194α bakterilerine ait süpernatant kısımlar sıcaklığa maruz bırakılarak mezofilik kökenli proteinler denatüre edilmiştir. Denatüre proteinler ortamdan uzaklaştırılarak ortamda kalan sıcaklığa dirençli α-amilaz enzimi SDS-Nişasta-PAGE de önce Coomassie blue, sonra da iyot boyaması ile gösterilmiştir. Coomassie blue boyaması ile, gerek YB886/pC194α gerekse BR151/pC194α bakterilerine ait mezofilik kökenli proteinlerin sıcaklık uygulaması ile denatüre olduğu, B. stearothermophilus kökenli sıcaklığa dirençli α-amilaz enziminin ise B. subtilis ATCC31786/pC194α dan izole edilen α-amilaz enzimi ile aynı moleküler büyüklükte bant verdikleri gözlenmiştir (Şekil 4.7-A.). Bu üç B. subtilis suşuna (ATCC31786/pC194α, YB886/pC194α ve BR151/pC194α) ait sıcaklığa maruz bırakılmamış grupta bütün hücredışı proteinlerin bant oluşturduğu gözlenirken, kontrol amacıyla kullanılan B. subtilis YB886 da (αamilaz - ) ise sıcaklık uygulaması ile bütün proteinlerin denatüre olarak hiçbir bant vermediği gözlenmiştir (Şekil 4.7-A.). 64

82 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Sözkonusu SDS-Nişasta-PAGE jelin iyot ile boyanması sonucu, denatürasyon işlemine tabi tutulmuş grupta gözlenen tek bantların, denatüre edilmeyen grupta yer alan ve aynı hizada bulunan α-amilaz bantları ile beraber aktivite gösterdikleri gözlenmiştir (Şekil 4.7-B.). Şekil 4.7. Denatüre edilmiş ve edilmemiş B. subtilis kökenli proteinlerin SDS- Nişasta-PAGE de Coomassie blue (A) ve iyodin (B) boyaması ile gösterilmesi: M: Markır, 1: ATCC31786/pC194α (denatüre edilmemiş), 2: YB886/pC194α (denatüre edilmemiş), 3: BR151/pC194α (denatüre edilmemiş), 4: ATCC31786/pC194α (denatüre edilmiş), 5: YB886/pC194α (denatüre edilmiş), 6: BR151/pC194α (denatüre edilmiş), 7: YB886 (denatüre edilmiş-kontrol) Sıcaklığa Dirençli β-amilaz Geninin Klonlanmasına Yönelik Bulgular Sıcaklığa Dirençli β-amilaz Geninin E. coli de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geninin PCR ile Amplifikasyonu T. thermosulfurogenes bakterisi kromozomunda bulunan sıcaklığa dirençli β- amilaz geni PCR ile amplifiye edilerek β-amilaz geni içeren yaklaşık 1.95 kbç büyüklüğündeki DNA bandı %0.8 lik agaroz jelde gösterilmiştir (Şekil 4.8.). 65

83 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil 4.8. β-amilaz genine ait PCR ürününün %0.8 lik agaroz jeldeki elektroforezi: M: markır, 1: T. thermosulfurogenes kromozomal DNA sı, 2: PCR ürünü β-amilaz geni taşıyan DNA parçası (2). Sıcaklığa Dirençli β-amilaz Geninin pbluescript II KS/SK Vektörüne Ligasyonu PCR ile amplifikasyonu yapılan sıcaklığa dirençli β-amilaz geni taşıyan DNA parçası agaroz jelden saflaştırılarak Sma I enzimi ile düz zincir haline getirilmiş olan pbluescript II KS/SK plazmid DNA sına ligasyonu yapılmıştır. Elde edilen ligasyon karışımı E. coli XL1 Blue MRF' bakterisine transfer edilmiştir (3). pbluescript II KS/SK + β-amilaz (pbluescriptβ) Vektörü Taşıyan Rekombinant E. coli Kolonilerinin Tespiti β-amilaz genini içeren pbluescriptβ vektörünün transferi sonucunda LB/Agar/Amp/Xgal plaklarında rekombinant (beyaz) ve non-rekombinant (mavi) kolonilerin geliştiği gözlenmiştir (Şekil 4.9.). 66

84 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil 4.9. LB/Agar/Amp/Xgal plaklarında rekombinant (beyaz) ve non-rekombinant (mavi) E. coli XL1 Blue MRF' kolonilerinin gelişimi Burada non-rekombinant bakteriler, pbluescript II KS/SK plazmid DNA sının üzerinde bulunan LacZ geninden dolayı ortamdaki X-gal i parçalayarak mavi renkte koloni oluşturmuşlardır. Rekombinant bakteriler ise, içerisine β-amilaz geninin girmesinden dolayı LacZ geni mutasyona uğrayarak inaktif hale geçmiş ve ortamdaki X-gal i parçalayamayarak beyaz renkli koloni oluşturmuşlardır. Transformasyon plağında gelişen beyaz renkli rekombinant kolonilerden bazıları yeni LB/Agar/Amp plaklarına aktarılmış, koloni gelişimi tamamlandıktan sonra bu plakların iyot buharı ile boyanması sonucu etrafında beyazımtrak zon veren β-amilaz pozitif (+) koloniler tespit edilmiştir (Şekil 4.10.). β-amilaz (+) zon veren kolonilerden 7 tanesi seçilerek β-amilaz negatif (-) bir koloniyle beraber yeni bir LB/Agar/Amp plağına aktarılmış ve koloni gelişimi tamamlandıktan sonra iyot buharıyla boyanarak β-amilaz negatif ve pozitif koloniler bir arada gösterilmiştir (Şekil 4.11.). 67

85 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil Transformasyon plağından aktarılan E. coli/pbluescriptβ kolonilerinin iyot buharıyla boyanması sonucu β-amilaz (+) olanların tespiti Şekil Bazı β-amilaz (+) kolonilerle (2, 5, 6, 8, 13, 19, 20) 1 adet β-amilaz (-) kontrol kolonisinin (K) tek bir plakta bir arada gösterilmesi (4). E. coli/pbluescriptβ Kolonilerinden pbluescriptβ Plazmidinin İzolasyonu, İnsört ve PCR Analizi Seçilen 7 adet rekombinant bakteriden pbluescriptβ plazmid DNA izolasyonu yapılmış ve elde dilen plazmid DNA lar Bam HI ile kesilmiştir. Yine kontrol 68

86 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN amacıyla transformasyon plağından seçilen beyaz renkli rekombinant β-amilaz (-) bir koloniden de plazmid DNA izolasyonu yapılarak aynı enzimle kesilmiştir. Kesim reaksiyonları %0.8 lik agaroz jelde incelenmiş ve rekombinant kolonilerden izole edilen plazmid DNA ların pbluescript II KS/SK (2.9 kbç) ve β-amilaz (1.95 kbç) DNA parçalarını kapsayan 2 adet bant verdikleri gözlenmiştir (Şekil 4.12.). Kontrol plazmidinin kesilmesi sonucu ise 2.9 ve 0.5 kbç lik iki adet bandın ortaya çıktığı görülmüştür (Şekil 4.12.). Bu da ligasyon esnasında pbluescript II KS/SK plazmidinin yaklaşık 0.5 kbç lik başka bir non-spesifik (muhtemelen spesifik olmayan PCR ürünü) DNA parçasını aldığını ve E. coli XL1 Blue MRF' bakterisine transfer olarak beyaz renkli koloni oluşturduğunu göstermektedir. A B C Şekil β-amilaz (+) koloniler ile bir adet β-amilaz (-) koloniden izole edilen plazmid DNA ların Bam HI enzimi ile kesim reaksiyonunun agaroz jel elektroforezi: M: Markır, 1-7: β-amilaz (+) kolonilerden izole edilen plazmid DNA ların kesimi, 8: β-amilaz (-) koloniden izole edilen plazmid DNA nın kesimi (A: pbluescript II KS/SK, B: β-amilaz geni taşıyan DNA parçası, C: Non-spesifik PCR ürünü) pbluescriptβ plazmid DNA sı, β-amilaz geni içerisinde kesim noktası bulunmayan, fakat pbluescript II KS/SK DNA sını çoklu klonlama bölgesi içinde (MCS) tek bir noktadan kesen Eco RI enzimi ile kesilerek rekombinant halde düz zincir (doğrusal) hale getirilerek agaroz jelde 4.9 kbç uzunluğunda tek bir bant 69

87 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN gözlenmiştir (Şekil 4.13., sıra-4). Yine orijinal plazmid (pbluescript II KS/SK) Bam HI enzimi ile tek noktadan kesilerek düz bir zincir haline getirilmiş ve agaroz jelde 2.9 kbç lik tek bir bant üretmiştir (Şekil 4.13., sıra-3). Ayrıca hem T. thermosulfurogenes kromozomal DNA sı hem de rekombinant pbluescriptβ plazmid DNA sı kalıp olarak kullanılmış ve yaklaşık 1.95 kbç lik PCR ürünü β-amilaz genleri sentezlenmiştir (Şekil 4.13., sıra-5 ve 6). Son olarak, elde edilen her iki PCR ürünü DNA lar, β-amilaz genini tek noktadan kesen Hind III enzimi ile kesilerek 1.5 ve 0.5 kbç lik iki fragmente ayrıştırılmıştır (Şekil 4.13., sıra-7 ve 8). Şekil β-amilaz geninin klonlanmasına ilişkin kapsamlı analiz: M: markır, 1: pbluescriptβ plazmid DNA sı, 2: pbluescriptβ/bam HI kesimi, 3: pbluescript II KS/SK/Bam HI kesimi, 4: pbluescriptβ/eco RI kesimi, 5: T. thermosulfurogenes DNA sı kullanılarak sentezlenen ve β-amilaz geni taşıyan PCR ürünü, 6: pbluescriptβ plazmidi kullanılarak sentezlenen ve β-amilaz geni taşıyan PCR ürünü, 7: T. thermosulfurogenes DNA sı kullanılarak sentezlenen ve β-amilaz geni taşıyan PCR ürününün Hind III enzimi ile kesimi, 8: pbluescriptβ plazmidi kullanılarak sentezlenen ve β- amilaz geni taşıyan PCR ürününün Hind III enzimi ile kesimi 70

88 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN β-amilaz Geninin B. subtilis BR151 ve B. amyloliquefaciens de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geni ile pub110 Vektörünün Ligasyonu pbluescriptβ vektöründen Bam HI enzimi ile kesilerek çıkarılan β-amilaz geni ile yine Bam HI enzimi ile kesilerek doğrusal hale getirilmiş olan pub110 vektörünün ligasyonu yapılmıştır. Ligasyon karışımından bir miktar alınarak B. subtilis BR151 ve B. amyloliquefaciens bakterilerine elektroporasyon tekniği ile aktarılmıştır (2). pub110β Taşıyan B. subtilis BR151/pUB110β ve B. amyloliquefaciens/pub110β Rekombinantlarının Tespiti B. subtilis BR151/pUB110β ve B. amyloliquefaciens/pub110β bakterileri ile orijinal bakteriler (B. subtilis BR151 ve B. amyloliquefaciens) plak testi için LB/Nişasta/Agar ve LB/Nişasta/Agar/Kan plaklarına steril kürdan yardımı ile ekilmiştir. LB/Nişasta/Agar plağında gerek orijinal gerekse rekombinant bakterilerin ürediği gözlenirken, LB/Nişasta/Agar/Kan plağında sadece rekombinant bakterilerin ürediği gözlenmiştir (Şekil 4.14.). 71

89 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil B. subtilis BR151, B. subtilis BR151/pUB110β, B. amyloliquefaciens, B. amyloliquefaciens/pub110β bakterilerinin LB/Nişasta/Agar ve LB/Nişasta/Agar/Kan plaklarında koloni gelişimleri bakımından karşılaştırılması: 1a: B. subtilis BR151 (α-amilaz -, β-amilaz - ), 1b: B. subtilis BR151/pUB110β (α-amilaz -, β-amilaz + ), 2a: B. amyloliquefaciens (α-amilaz +, β-amilaz - ), 2b: B. amyloliquefaciens/pub110β (α-amilaz +, β- amilaz + ), +/-: Kolonilerin üreme durumu Bakteri gelişimleri tamamlandıktan sonra gerek 37 gerekse 60 ºC de inkübe edilen antibiyotikli ve antibiyotiksiz plaklar iyot buharıyla boyanarak amilolitik aktiviteleri ortaya çıkarılmıştır. Boyama sonucunda, 37 ve 60 ºC de inkübe edilen antibiyotiksiz plaklarda, B. subtilis BR151 (α-amilaz - ve β-amilaz - ) bakterisinin etrafında hiçbir zon gözlenmezken, rekombinant B. subtilis BR151/pUB110β bakterisinin etrafında da yine hiçbir zon gözlenememiştir (Şekil 4.15., No: 1a-1b). B. amyloliquefaciens (α-amilaz +, β-amilaz - ) bakterisi her iki plakta da beyazımtırak zon verirken, rekombinant B. amyloliquefaciens/pub110β bakterisi de yine her iki plakta aynı zonu vermiştir (Şekil 4.15., No: 2a-2b). 72

90 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil Orijinal ve rekombinant bakterilerin 37 ve 60 ºC de inkübe edilmiş LB/Nişasta/Agar plaklarında iyot boyaması ile test edilmesi: 1a: B. subtilis BR151 (α-amilaz -, β-amilaz - ), 1b: B. subtilis BR151/pUB110β (αamilaz -, β-amilaz + ), 2a: B. amyloliquefaciens (α-amilaz +, β-amilaz - ), 2b: B. amyloliquefaciens/pub110β (α-amilaz +, β-amilaz + ), +/-: Kolonilerin üreme durumu Antibiyotik içeren ve sadece rekombinant bakterilerin ürediği plaklar boyandığında B. subtilis BR151/pUB110β bakterisinin etrafında her iki plakta da zon gözlenmezken, B. amyloliquefaciens/pc194α bakterisinin yine her iki plakta da α- amilaz kaynaklı zon oluşturduğu gözlenmiştir (Şekil 4.16.). Şekil Orijinal ve rekombinant bakterilerin 37 ve 60 ºC de inkübe edilmiş LB/Nişasta/Agar/Kan plaklarında iyot boyaması ile test edilmesi: 1a: B. subtilis BR151 (α-amilaz -, β-amilaz - ), 1b: B. subtilis BR151/pUB110β (αamilaz -, β-amilaz + ), 2a: B. amyloliquefaciens (α-amilaz +, β-amilaz - ), 2b: B. amyloliquefaciens/pub110β (α-amilaz +, β-amilaz + ), +/-: Kolonilerin üreme durumu 73

91 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN (3). Rekombinant pub110β ya İlişkin İnsört ve PCR Analizleri Gerek B. amyloliquefaciens/pub110β gerekse B. subtilis BR151/pUB110β bakterilerinden rekombinant pub110β vektörleri izole edilmiştir. Sıcaklığa dirençli β-amilaz geninin pub110 vektörüne entegrasyonu Bam HI enzimi ile yapıldığından geni tekrar çıkartmak için rekombinant pub110β plazmidi aynı enzimle tekrar kesilmiştir. Kesim sonucu yaklaşık 4.5 kbç lik pub110 bandı ile 1.95 kbç lik β- amilaz geni bantı agaroz jel elektroforezde gözlenmiştir. Yine orijinal plazmid de (pub110) Bam HI enzimi ile kesilerek düz zincir hale getirilmiş ve yaklaşık 4.5 kbç lik tek bir bant üretilmiştir (Şekil 4.17.). Rekombinant pub110β vektörleri kalıp DNA olarak kullanılmış ve yaklaşık 1.95 kbç lik PCR ürünü β-amilaz genleri sentezlenmiştir. Son olarak, elde edilen her iki PCR ürünü DNA lar, β-amilaz genini tek noktadan kesen Hind III enzimi ile kesilerek 1.5 ve 0.5 kbç lik iki fragmente ayrılmıştır. Elde edilen PCR ürünleri ile bu PCR ürünlerinin kesim analizleri de %0.8 lik agaroz jelde görüntülenmiştir (Şekil 4.17.). Şekil pub110β nın kesim ve PCR analizleri: M: markır, 1: pub110β/bam HI, 2: pub110/bam HI, 3 ve 4: B. amyloliquefaciens/pub110β ve B. subtilis BR151/pUB110β dan izole edilen pub110β kullanılarak sentezlenen PCR ürünleri (sırasıyla), 5 ve 6: B. amyloliquefaciens/pub110β ve B. subtilis BR151/pUB110β dan izole edilen pub110β kullanılarak sentezlenen PCR ürünlerinin Hind III enzimi ile kesimi (sırasıyla) 74

92 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Sıcaklığa Dirençli β-amilaz Geninin Laktik Asit Bakterilerinde Klonlanması Çalışmaları (1). pbt10β Rekombinant Vektörünün Oluşturulması ve Ara Konakçı E. coli ye Transferi Bir E. coli/streptococcus mekik vektörü olan pl2 plazmid DNA sı Bam HI enzimi ile kesilerek lizozim geni uzaklaştırılmış, geriye kalan pbluescript II KS/SK + ptrw10 R.O. kısmı ise (pbt10) agaroz jelden saflaştırılarak sıcaklığa dirençli β- amilaz genine ligasyonu yapılmıştır. Ligasyon karışımı (pbt10β) E. coli XL1 Blue MRF' bakterisine transfer edilmiştir (2). Rekombinant E. coli Kolonilerinin Seçimi ve Karakterizasyonu Transformasyon plağında gelişen E. coli kolonilerden (Şekil 4.18.) 4 tanesi steril kürdan yardımı ile LB/Agar/Amp plağına ekilmiş, koloni gelişimi tamamlandıktan sonra plak iyot buharı ile boyanmıştır. Boyama sonucunda 4 koloni de β-amilaz + bulunmuştur (Şekil 4.19.). Şekil LB/Agar/Amp plağında gelişen ve pbt10β plazmidi taşıyan rekombinant E. coli/pbt10β kolonileri 75

93 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil pbt10β taşıyan rekombinant E. coli/pbt10β kolonilerinin 37 ve 60 ºC de inkübe edilmiş LB/Nişasta/Agar/Amp plaklarında iyot boyaması ile gösterilmesi (3). β-amilaz Geninin pbt10β Vektöründen PCR ile Sentezlenmesi β-amilaz pozitif E. coli/pbt10β kolonilerinden bir tanesi seçilerek plazmid DNA izolasyonu yapılmıştır. İzole edilen plazmid DNA kalıp olarak kullanılmış ve β-amilaz geni PCR ile sentezlenmiştir. Elde dilen PCR ürünü Hind III enzimi ile kesilerek yaklaşık 1.5 ve 0.5 kbç lik iki fragment elde edilmiştir. Gerek PCR ürünü, gerekse PCR ürününün Hind III enzimi ile kesim analizi agaroz jel elektroforezde görüntülenmiştir (Şekil 4.20.). 76

94 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil pbt10β DNA sının PCR ve kesim analizi: M: markır, 1: PCR ürünü β- amilaz geni, 2 ve 3: Elde edilen PCR ürününün Hind III enzimi ile kesimi Sıcaklığa Dirençli β-amilaz Geninin pnw33n Vektörüne Takılarak Yeniden B. subtilis de Klonlanması (1). Sıcaklığa Dirençli β-amilaz Geni ile pnw33n Vektörünün Ligasyonu ve Ara Konakçı E. coli XL1 Blue MRF' Bakterisine Transferi Bam HI enzimi ile kesilerek doğrusal hale getirilen ve B. subtilis / B. stearothermophilus / E. coli mekik vektörü olan pnw33n plazmid DNA sı ile β- amilaz geninin ligasyonu yapılmıştır. Daha sonra ligasyon karışımı E. coli XL1 Blue MRF' bakterisine transferde kullanılmıştır (2). pnw33nβ Taşıyan Rekombinant E. coli Kolonilerinin Tespiti β-amilaz genini içeren pnw33nβ vektörünün transferi sonucunda LB/Agar/Cml plaklarında rekombinant E. coli/pnw33nβ kolonilerinin geliştiği gözlenmiştir (Şekil 4.21.). 77

95 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil pnw33nβ taşıyan rekombinant E. coli/pnw33nβ kolonilerinin LB/Nişasta/Agar/Cml plaklarında iyot boyaması ile gösterilmesi (3). pnw33nβ Vektörünün İnsört ve PCR Analizi Şekil de verilen plaktan seçilen bir adet koloniden pnw33nβ plazmid DNA sı izole edilerek Bam HI enzimi ile kesilmiştir. Kesim reaksiyonu agaroz jelde elektroforez edildiğinde yaklaşık 3.8 kbç lik pnw33n bandı ile 1.95 kbç lik β- amilaz geni bandı gözlenmiştir (Şekil 4.22.). Kontrol amacıyla pnw33n plazmid DNA sı da Bam HI enzimi ile tek noktadan kesilerek doğrusal hale getirilmiş ve agaroz jel elektroforezde 3.8 kbç lik tek bir bant gözlenmiştir (Şekil 4.22.). Ayrıca hem T. thermosulfurogenes kromozomal DNA sı hem de rekombinant pnw33nβ plazmid DNA sı kalıp olarak kullanılmış ve PCR ürünü β-amilaz geni sentezlenmiştir (Şekil 4.22.). 78

96 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil pnw33nβ nın kesim ve PCR analizi: M: markır, 1: pnw33nβ, 2: pnw33nβ/bam HI, 3: pnw33n/bam HI, 4: pnw33nβ kullanılarak sentezlenen ve β-amilaz geni taşıyan PCR ürünü, 5: T. thermosulfurogenes DNA sı kullanılarak sentezlenen ve β-amilaz geni taşıyan PCR ürünü Bakterilere Ait Toplam Proteinlerin SDS-PAGE de Karşılaştırılması E. coli/pbluescriptβ bakterisine ait hücreiçi ve hücredışı proteinleri ile B. subtilis BR151/pUB110β, B. amyloliquefaciens/pub110β ve T. thermosulfurogenes bakterilerine ait hücredışı proteinler Coomassie blue boyaması ile SDS-PAGE de karşılaştırılmıştır. Sözkonusu jelin daha sonra iyot ile boyanması sonucunda, Coomassie blue boyamasında ortaya çıkan ve yaklaşık 57 kda büyüklüğüne tekabül eden T. thermosulfurogenes bakterisine ait tek bir bandın (Şekil 4.23.), diğer bakterilerde de bulunan ve aynı moleküler ağırlığa sahip bantlarla beraber açık renkli bir zon verdiği gözlenmiştir (Şekil 4.24.). 79

97 4. BULGULAR VE TARTIŞMA Bahri Devrim ÖZCAN Şekil β-amilaz geni taşıyan bakterilere ait toplam proteinlerin SDS-PAGE de gösterilmesi: M: markır; 1: E. coli/pbluescriptβ bakterisine ait hücredışı proteinler, 2: E. coli/pbluescriptβ bakterisine ait hücreiçi proteinler, 3: B. subtilis BR151/pUB110β, 4: B. amyloliquefaciens/pub110β, 5: T. thermosulfurogenes Şekil β-amilaz geni taşıyan bakterilerin SDS-Nişasta-PAGE de zymogram analizi: M: markır; 1: E. coli/pbluescriptβ bakterisine ait hücredışı proteinler, 2: E. coli/pbluescriptβ bakterisine ait hücreiçi proteinler, 3: B. subtilis BR151/pUB110β, 4: B. amyloliquefaciens/pub110β, 5: T. thermosulfurogenes 80

NATURAZYME Naturazyme enzim grubu karbohidrazlar, proteaz ve fitaz enzimlerini içerir.

NATURAZYME Naturazyme enzim grubu karbohidrazlar, proteaz ve fitaz enzimlerini içerir. NATURAZYME Naturazyme enzim grubu karbohidrazlar, proteaz ve fitaz enzimlerini içerir. Tüm hayvanlar besinleri sindirmek için enzimleri kullanırlar. Bunlar hem hayvanın kendi sentezlediği hem de bünyelerinde

Detaylı

Fitik asit gıdaların fonksiyonel ve besinsel özellikleri üzerine önemli etkileri olan doğal bileşenlerin kompleks bir sınıfını oluşturmaktadır.

Fitik asit gıdaların fonksiyonel ve besinsel özellikleri üzerine önemli etkileri olan doğal bileşenlerin kompleks bir sınıfını oluşturmaktadır. FİTİK ASİT İN BESLENMEDEKİ ÖNEMİ FİTİK ASİT NEDİR? Fitik asit gıdaların fonksiyonel ve besinsel özellikleri üzerine önemli etkileri olan doğal bileşenlerin kompleks bir sınıfını oluşturmaktadır. Birçok

Detaylı

Karbohidratlar. Karbohidratların sınıflandırılması. Monosakkaritler

Karbohidratlar. Karbohidratların sınıflandırılması. Monosakkaritler Karbohidratlar Yeryüzünde en çok bulunan organik molekül grubudur, (CH 2 O) n genel formülüyle ifade edilebilirler. Genelde suda çözünürler, Güneş ışığının fotosentez yapan organizmalar tarafından tutulmasıyla

Detaylı

Hatice YILDIRAN. Gıda Mühendisi BURDUR İL MÜDÜRLÜĞÜ

Hatice YILDIRAN. Gıda Mühendisi BURDUR İL MÜDÜRLÜĞÜ Hatice YILDIRAN Gıda Mühendisi BURDUR İL MÜDÜRLÜĞÜ GIDA TAKVİYELERİ Eğitim Yeri Eğitim Konusu : HOLLANDA-TNO : Gıda Takviyeleri Eğitim Süresi : 21 Aralık 2012-20 Mart 2013 Danışman : Dr. Koen VENEMA Eğitim

Detaylı

Gıda Kimyası II Gıdaların işlenmesi sırasında ortaya çıkan reaksiyonlar. Vural Gökmen

Gıda Kimyası II Gıdaların işlenmesi sırasında ortaya çıkan reaksiyonlar. Vural Gökmen Gıda Kimyası II Gıdaların işlenmesi sırasında ortaya çıkan reaksiyonlar Vural Gökmen Gıda İşleme Gıda işlemenin derecesi (şiddeti) Gıda işlemenin nedenleri Gıda işleme şekilleri Aşırı işlenmişgıdalar üzerinekaygılar

Detaylı

III-Hayatın Oluşturan Kimyasal Birimler

III-Hayatın Oluşturan Kimyasal Birimler III-Hayatın Oluşturan Kimyasal Birimler MBG 111 BİYOLOJİ I 3.1.Karbon:Biyolojik Moleküllerin İskeleti *Karbon bütün biyolojik moleküllerin omurgasıdır, çünkü dört kovalent bağ yapabilir ve uzun zincirler

Detaylı

Laboratuvar Tekniği. Adnan Menderes Üniversitesi Tarımsal Biyoteknoloji Bölümü TBY 118 Muavviz Ayvaz (Yrd. Doç. Dr.) 5. Hafta (14.03.

Laboratuvar Tekniği. Adnan Menderes Üniversitesi Tarımsal Biyoteknoloji Bölümü TBY 118 Muavviz Ayvaz (Yrd. Doç. Dr.) 5. Hafta (14.03. Laboratuvar Tekniği Adnan Menderes Üniversitesi Tarımsal Biyoteknoloji TBY 118 Muavviz Ayvaz (Yrd. Doç. Dr.) 5. Hafta (14.03.2014) 1 5. Haftanın Ders İçeriği DNA ekstraksiyonu DNA ekstraksiyonunun amacı

Detaylı

HAZ. ADI PROGRAM ÜNİVERSİTE ENSTİTÜ ANABİLİM KONU DURUMU BAŞ.TARİH BİTİŞ TARİH GENEL BİYOLOJİ ANABİLİM DALI

HAZ. ADI PROGRAM ÜNİVERSİTE ENSTİTÜ ANABİLİM KONU DURUMU BAŞ.TARİH BİTİŞ TARİH GENEL BİYOLOJİ ANABİLİM DALI ÖZGEÇMİŞ TC KİMLİK NO: PERSONEL AD: SOYAD: DOĞUM TARİHİ: SİCİL NO: UYRUK: EHLİYET: 12535301842 MUTLUNİSA ÜNALDI ÇORAL 10/13/72 12:00 AM A93844 B DİL ADI SINAV ADI PUAN SEVİYE YIL DÖNEM İngilizce KPDS 79

Detaylı

DÖNEM 1- A, 3. DERS KURULU (2015-2016)

DÖNEM 1- A, 3. DERS KURULU (2015-2016) DÖNEM 1- A, 3. DERS KURULU (2015-2016) DERS SAATİ DERS ADI DERS KONUSU DERSİ VEREN ÖĞRETİM ÜYESİ 4. DK 1. Hafta 07 Aralık Pazartesi Mikrobiyoloji Mikrobiyolojinin tarihçesi ve mikroorganizmalara genel

Detaylı

Hafta VIII Rekombinant DNA Teknolojileri

Hafta VIII Rekombinant DNA Teknolojileri GENETĐK 111-503 Hafta VIII Rekombinant DNA Teknolojileri Doç.Dr. Hilâl Özdağ Rekombinant DNA Teknolojisi Amaç Spesifik DNA dizilerinin yerlerinin belirlenmesi. DNA nın belirli noktalardan kesilmesi Belirli

Detaylı

DOĞAL ORTAMLARDA B. AMYLOLIQUEFACIENS İLE α-amilaz ÜRETİMİNİN İNCELENMESİ ÖZET

DOĞAL ORTAMLARDA B. AMYLOLIQUEFACIENS İLE α-amilaz ÜRETİMİNİN İNCELENMESİ ÖZET DOĞAL ORTAMLARDA B. AMYLOLIQUEFACIENS İLE α-amilaz ÜRETİMİNİN İNCELENMESİ M. Ş. TANYILDIZI, M. ELİBOL, D. ÖZER Fırat Üniversitesi, Kimya Mühendisliği Bölümü, 23119, ELAZIĞ ÖZET Son yıllarda endüstriyel

Detaylı

KARBONHİDRATLAR. Glukoz İNSAN BİYOLOJİSİ VE BESLENMESİ AÇISINDAN ÖNEMLİ OLAN

KARBONHİDRATLAR. Glukoz İNSAN BİYOLOJİSİ VE BESLENMESİ AÇISINDAN ÖNEMLİ OLAN KARBONHİDRATLAR Normal diyet alan kişilerde enerjinin % 55-60 ı karbonhidratlardan sağlanır. Bitkiler karbonhidratları fotosentez yoluyla güneş ışığının yardımıyla karbondioksit ve sudan yararlanarak klorofilden

Detaylı

DİDEM AYKAN ( ) TUĞBA DENİZ ( ) MELİKE ACAR ( ) Gazi Eğitim Fakültesi GAZİ ÜNİVERSİTESİ

DİDEM AYKAN ( ) TUĞBA DENİZ ( ) MELİKE ACAR ( ) Gazi Eğitim Fakültesi GAZİ ÜNİVERSİTESİ DİDEM AYKAN (050559006) TUĞBA DENİZ (050559011) YEKTA ARTUVAN (050559003) MELİKE ACAR (050559001) Doç. Dr. Figen ERKOÇ Gazi Eğitim Fakültesi GAZİ ÜNİVERSİTESİ Amilaz Ca++ gerektiren metalloenzimdir. α-1

Detaylı

Biyoteknoloji ve Genetik I Hafta 12. Prokaryotlarda Gen İfadesinin Düzenlenmesi

Biyoteknoloji ve Genetik I Hafta 12. Prokaryotlarda Gen İfadesinin Düzenlenmesi Biyoteknoloji ve Genetik I Hafta 12 Prokaryotlarda Gen İfadesinin Düzenlenmesi Prof. Dr. Hilal Özdağ A.Ü Biyoteknoloji Enstitüsü Merkez Laboratuvarı Tel: 2225826/125 Eposta: hilalozdag@gmail.com Gen İfadesi

Detaylı

BAKTERİLERİN GENETİK KARAKTERLERİ

BAKTERİLERİN GENETİK KARAKTERLERİ BAKTERİLERİN GENETİK KARAKTERLERİ GENETİK MATERYALLER VE YAPILARI HER HÜCREDE Genetik bilgilerin kodlandığı bir DNA genomu bulunur Bu genetik bilgiler mrna ve ribozomlar aracılığı ile proteinlere dönüştürülür

Detaylı

Organik Bileşikler. Karbonhidratlar. Organik Bileşikler YGS Biyoloji 1

Organik Bileşikler. Karbonhidratlar. Organik Bileşikler YGS Biyoloji 1 Organik Bileşikler YGS Biyoloji 1 Hazırladığımız bu yazıda; organik bileşikler ve organik bileşiklerin yapısını, canlılarda bulunan organik bileşikleri ve bunların görevlerini, kullanım alanlarını, canlılar

Detaylı

KALITIM #12 MODERN GENETİK UYGULAMALARI (BİYOTEKNOLOJİ) SELİN HOCA

KALITIM #12 MODERN GENETİK UYGULAMALARI (BİYOTEKNOLOJİ) SELİN HOCA KALITIM #12 MODERN GENETİK UYGULAMALARI (BİYOTEKNOLOJİ) SELİN HOCA BİYOTEKNOLOJİ Canlılara temel bilimlerin ve mühendislik ilkelerinin uygulanmasıdır. Gen mühendisliği, genetik madde lan DNA üzerinde yapılan

Detaylı

YGS ANAHTAR SORULAR #2

YGS ANAHTAR SORULAR #2 YGS ANAHTAR SORULAR #2 1) Bir hayvan hücresinde laktoz yapımı ile ilgili olarak, sitoplazmadaki madde miktarının değişimlerini gösteren grafik aşağıdakilerden hangisi olamaz? A) Glikoz B) Su miktarı 2)

Detaylı

KİMYASAL VE FİZİKSEL ÖZELLİKLERİ SEBEBİYLE MİKROBİYEL GELİŞMEYE EN UYGUN, DOLAYISIYLA BOZULMAYA EN YATKIN, GIDALARDAN BİRİDİR.

KİMYASAL VE FİZİKSEL ÖZELLİKLERİ SEBEBİYLE MİKROBİYEL GELİŞMEYE EN UYGUN, DOLAYISIYLA BOZULMAYA EN YATKIN, GIDALARDAN BİRİDİR. KIRMIZI ETLER KİMYASAL VE FİZİKSEL ÖZELLİKLERİ SEBEBİYLE MİKROBİYEL GELİŞMEYE EN UYGUN, DOLAYISIYLA BOZULMAYA EN YATKIN, GIDALARDAN BİRİDİR. ETTEKİ ENZİMLER VE MİKROBİYEL AKTİVİTE BOZULMANIN BAŞLANGICIDIR.

Detaylı

REKOMBİNANT E.coli KÜLTÜRLERİ İLE ENZİM ÜRETİMİNİN KİNETİK ÖZELLİKLERİNİN İNCELENMESİ. Dilek KAZAN, Amable HOKTAÇSU ve Agnes ÇAMURDAN

REKOMBİNANT E.coli KÜLTÜRLERİ İLE ENZİM ÜRETİMİNİN KİNETİK ÖZELLİKLERİNİN İNCELENMESİ. Dilek KAZAN, Amable HOKTAÇSU ve Agnes ÇAMURDAN REKOMBİNANT E.coli KÜLTÜRLERİ İLE ENZİM ÜRETİMİNİN KİNETİK ÖZELLİKLERİNİN İNCELENMESİ Dilek KAZAN, Amable HOKTAÇSU ve Agnes ÇAMURDAN Boğaziçi Üniversitesi. Mühendislik fakültesukimya Mühendisliği Bolümü

Detaylı

Çamlı, BioAqua markası altında ürettiği balık yemleri ile müşterilerine çok geniş bir ürün segmenti sunmaktadır. Ağırlıklı olarak üretilen Levrek,

Çamlı, BioAqua markası altında ürettiği balık yemleri ile müşterilerine çok geniş bir ürün segmenti sunmaktadır. Ağırlıklı olarak üretilen Levrek, YEMLERİ EVREK & ÇİPURA L 1 Çamlı, BioAqua markası altında ürettiği balık yemleri ile müşterilerine çok geniş bir ürün segmenti sunmaktadır. Ağırlıklı olarak üretilen Levrek, Çipura ve Alabalık yemlerinin

Detaylı

Niçin PCR? Dr. Abdullah Tuli

Niçin PCR? Dr. Abdullah Tuli Niçin PCR? Dr. Abdullah Tuli 1980 lerin Başı Bir yöntem düşünün Tepkimeyi gerçekleştirmek kolay mıdır? Bu yöntem çok mu karmaşıktır, yoksa basit mi? Yöntemde kullanılan örnek, saf mı ya da son derece karmaşık

Detaylı

ENZİME DİRENÇLİ NİŞASTA

ENZİME DİRENÇLİ NİŞASTA ENZİME DİRENÇLİ NİŞASTA Nişasta granülü -D-glukoz polimeri lineer polimer = amiloz dallanmış polimer = amilopektin Oluşumu ve Özellikleri amiloz miktarı: %17 (pirinç)- %38 (mercimek) %20-27 (hububat ve

Detaylı

SÜT ENDÜSTRİSİNDEKİ YARARLI MİKROORGANİZMALAR

SÜT ENDÜSTRİSİNDEKİ YARARLI MİKROORGANİZMALAR SÜT ENDÜSTRİSİNDEKİ YARARLI MİKROORGANİZMALAR Süt ve süt ürünleri mikrobiyolojisinde yararlı mikroorganizmalar temel olarak süt ürünlerinin üretilmesinde kullanılan çeşitli mikroorganizmaları tanımlamaktadır.

Detaylı

Organik Atıkların Değerlendirilmesi- BİYOGAZ: Üretimi ve Kullanımı ECS KĐMYA ĐNŞ. SAN. VE TĐC. LTD. ŞTĐ.

Organik Atıkların Değerlendirilmesi- BİYOGAZ: Üretimi ve Kullanımı ECS KĐMYA ĐNŞ. SAN. VE TĐC. LTD. ŞTĐ. Organik Atıkların Değerlendirilmesi- BİYOGAZ: Üretimi ve Kullanımı ECS KĐMYA ĐNŞ. SAN. VE TĐC. LTD. ŞTĐ. BİYOGAZ NEDİR? Anaerobik şartlarda, organik atıkların çeşitli mikroorganizmalarca çürütülmesi sonucu

Detaylı

HAYVANCILIKTA BİYOTEKNOLOJİK UYGULAMALAR

HAYVANCILIKTA BİYOTEKNOLOJİK UYGULAMALAR HAYVANCILIKTA BİYOTEKNOLOJİK UYGULAMALAR Dünya Nüfusu Günümüzde---6.2 milyar 2020---8 milyar (6.7 milyarı GOÜ) (FAO, 2003) 2050---9.1 milyar (WHO) Nüfus İşlenebilir Tarım Alanı Dünya nüfusunun artması

Detaylı

*Türden türe değişkenlik gösterir. *İnsanın sadece barsak mikroflorasında 100 türün üzerinde 100 trilyondan fazla bakteri mevcuttur.

*Türden türe değişkenlik gösterir. *İnsanın sadece barsak mikroflorasında 100 türün üzerinde 100 trilyondan fazla bakteri mevcuttur. *Türden türe değişkenlik gösterir. *İnsanın sadece barsak mikroflorasında 100 türün üzerinde 100 trilyondan fazla bakteri mevcuttur. *İnsan üzerinde ya da içinde simbiyotik yaşam sürdüren 450-500 tür mikroflora

Detaylı

Protein Ekstraksiyonu

Protein Ekstraksiyonu Protein Ekstraksiyonu Dr.Gaye Güler Tezel Hacettepe Üniversitesi Tıp Fakültesi Patoloji Anabilim Dalı Proteinler tüm canlı organizmalar için en önemli makromoleküllerden biridir. Bazıları yapısal komponentleri

Detaylı

MOLEKÜLER BİYOLOJİ ANABİLİMDALI

MOLEKÜLER BİYOLOJİ ANABİLİMDALI MOLEKÜLER BİYOLOJİ ANABİLİMDALI Biyoloji bilimini klasik ve modern olmak üzere iki kategoriye ayırmak mümkündür. Klasik biyoloji içerisinde Zooloji ve Botanik alt bilim dalları yer alırlar ve daha genel

Detaylı

Biyoteknolojinin Temelleri

Biyoteknolojinin Temelleri Biyoteknolojinin Temelleri KİM 458 Prof. Dr. Y. Murat ELÇİN KİM 458 Biyoteknolojinin Temelleri Biyoteknolojiye Genel Bakış Prof. Dr. Y. Murat ELÇİN BİYOTEKNOLOJİ Mikroorganizmaların, hücre ve doku kültürlerinin

Detaylı

Monosakkaridler organizmadaki metabolik reaksiyonlara tek başlarına giremezler. Bu nedenle evvela aktifleşmeleri gerekir. Monosakkaridlerin aktif

Monosakkaridler organizmadaki metabolik reaksiyonlara tek başlarına giremezler. Bu nedenle evvela aktifleşmeleri gerekir. Monosakkaridlerin aktif Monosakkaridler organizmadaki metabolik reaksiyonlara tek başlarına giremezler. Bu nedenle evvela aktifleşmeleri gerekir. Monosakkaridlerin aktif formu, fosforik asitle yaptığı esterlerdir Glukoz, galaktoz

Detaylı

Kanatlılara Spesifik Performans Katkısı

Kanatlılara Spesifik Performans Katkısı Kanatlılara Spesifik Performans Katkısı İÇERİĞİ Kanatlı hayvancılık sektörü genetik calışmalar, yem teknolojisi ve beslenme rejimlerindeki bilimsel ilerlemelerle sürekli gelişmektedir. Dünyada artan kaliteli

Detaylı

BACILLUS AMYLOLIQUEFACIENS İLE α-amilaz ÜRETİMİNİN İNCELENMESİ

BACILLUS AMYLOLIQUEFACIENS İLE α-amilaz ÜRETİMİNİN İNCELENMESİ BACILLUS AMYLOLIQUEFACIENS İLE α-amilaz ÜRETİMİNİN İNCELENMESİ M. Ş. TANYILDIZI, M. ELİBOL, D. ÖZER Fırat Üniversitesi, Kimya Mühendisliği Bölümü, 9, ELAZIĞ ÖZET Giderek endüstriyel üretimde payı artan

Detaylı

GIDA BİYOTEKNOLOJİSİNDE GÜVENLİK GIDA BİYOTEKNOLOJİSİNDE UYGULAMALARI. Neslihan ATLIHAN

GIDA BİYOTEKNOLOJİSİNDE GÜVENLİK GIDA BİYOTEKNOLOJİSİNDE UYGULAMALARI. Neslihan ATLIHAN GIDA BİYOTEKNOLOJİSİNDE GÜVENLİK GIDA BİYOTEKNOLOJİSİNDE VE GDO UYGULAMALARI GÜVENLİK VE GDO UYGULAMALARI Neslihan ATLIHAN Neslihan ATLIHAN Gıda Yüksek Mühendisi Gıda Yüksek Mühendisi Gıda ve Yem Kontrol

Detaylı

Elektoforez ENSTRÜMENTAL ANALİZ 10/12/2015. Elektroforez

Elektoforez ENSTRÜMENTAL ANALİZ 10/12/2015. Elektroforez Elektoforez ENSTRÜMENTAL ANALİZ Elektroforez Elektroforez yüklü moleküllerin bir elektriksel alandaki hareketlerinin izlendiği bir tekniktir. Bir örnekteki maddelerin tümü veya bazıları iyonlaşabiliyorsa

Detaylı

ADIM ADIM YGS LYS. 93. Adım KALITIM -19 MODERN GENETİK UYGULAMALAR

ADIM ADIM YGS LYS. 93. Adım KALITIM -19 MODERN GENETİK UYGULAMALAR ADIM ADIM YGS LYS 93. Adım KALITIM -19 MODERN GENETİK UYGULAMALAR GEN KLONLAMA Seçilmiş bir genin plazmit ya da bir virüs içerisine yerleştirilerek bir bakteriye aktarılması ve bakteri aracılığı ile birçok

Detaylı

GIDA MÜHENDİSLİĞİ BÖLÜMÜ DOKTORA DERS KATALOĞU

GIDA MÜHENDİSLİĞİ BÖLÜMÜ DOKTORA DERS KATALOĞU DOKTORA DERS KATALOĞU ERCİYES ÜNİVERSİTESİ GDM 638 Lipid Kimyası Zorunlu DERS SAATİ: 3 Bahar Yrd. Doç. Dr. Hasan YALÇIN KREDİSİ :3 Tel:(352) 4374901 (32731), E-mail: hyalcin@erciyes.edu.tr, Web sayfası

Detaylı

12. SINIF KONU ANLATIMI 7 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI

12. SINIF KONU ANLATIMI 7 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI 12. SINIF KONU ANLATIMI 7 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI GENETİK MÜHENDİSLİĞİ Belirli bir amaca yönelik olarak genetik madde üzerinde yapılan çalışmaları içerir. Canlıların genlerine

Detaylı

SÜTÜN BİLEŞİMİ ve BESİN DEĞERİ

SÜTÜN BİLEŞİMİ ve BESİN DEĞERİ SÜTÜN BİLEŞİMİ ve BESİN DEĞERİ Prof. Dr. Metin ATAMER Ankara Üniversitesi Ziraat Fakültesi Süt Teknolojisi Bölümü Aralık 2006 ANKARA Sütün Tanımı ve Genel Nitelikleri Süt; dişi memeli hayvanların, doğumundan

Detaylı

Kanatlı Hayvan Hastalıkları

Kanatlı Hayvan Hastalıkları Kanatlı Hayvan Hastalıkları Kanatlı sektörü ile ilgili genel bilgiler 1930 Merkez Tavukçuluk Enstitüsü 1952 Saf ırkların ilk kez ithal edilmesi 1963 Damızlık (Parent stock) ithali 1970 Yatırımlarda artma

Detaylı

BALIKLARDA SİNDİRİM VE SİNDİRİM ENZİMLERİ. İlyas KUTLU Kimyager Su Ürünleri Sağlığı Bölümü. vücudun biyokimyasal süreçlerinin etkin bir şekilde

BALIKLARDA SİNDİRİM VE SİNDİRİM ENZİMLERİ. İlyas KUTLU Kimyager Su Ürünleri Sağlığı Bölümü. vücudun biyokimyasal süreçlerinin etkin bir şekilde BALIKLARDA SİNDİRİM VE SİNDİRİM ENZİMLERİ İlyas KUTLU Kimyager Su Ürünleri Sağlığı Bölümü Proteinler, yağlar ve karbohidratlar balıklar amino asitlerin dengeli bir karışımına gereksinim tarafından enerji

Detaylı

AVRASYA ÜNİVERSİTESİ

AVRASYA ÜNİVERSİTESİ Ders Tanıtım Formu Dersin Adı Öğretim Dili Moleküler Biyoloji Lab. Türkçe Dersin Verildiği Düzey Ön Lisans () Lisans (X) Yüksek Lisans( ) Doktora( ) Eğitim Öğretim Sistemi Örgün Öğretim (X) Uzaktan Öğretim(

Detaylı

TERMOFİL Bacillus sp. BAKTERİSİNDEN LICHENAZ (β-1,3 VE 1,4 GLUCANASE) ENZİMİ ÜRETİMİ, KARAKTERİZASYONU VE BİYOTEKNOLOJİK KULLANILABİLİRLİĞİ *

TERMOFİL Bacillus sp. BAKTERİSİNDEN LICHENAZ (β-1,3 VE 1,4 GLUCANASE) ENZİMİ ÜRETİMİ, KARAKTERİZASYONU VE BİYOTEKNOLOJİK KULLANILABİLİRLİĞİ * Ç.Ü Fen ve Mühendislik Bilimleri Dergisi Yıl:2012 Cilt:27-5 TERMOFİL Bacillus sp. BAKTERİSİNDEN LICHENAZ (β-1,3 VE 1,4 GLUCANASE) ENZİMİ ÜRETİMİ, KARAKTERİZASYONU VE BİYOTEKNOLOJİK KULLANILABİLİRLİĞİ *

Detaylı

Uygulamalı. Moleküler Biyoloji Teknikleri, Temel Mikrobiyoloji, Temel Biyokimya ve Laboratuvar Yönetimi Kursları. Yaz Dönemi Başlıyor!

Uygulamalı. Moleküler Biyoloji Teknikleri, Temel Mikrobiyoloji, Temel Biyokimya ve Laboratuvar Yönetimi Kursları. Yaz Dönemi Başlıyor! Uygulamalı Moleküler Biyoloji Teknikleri, Temel Mikrobiyoloji, Temel Biyokimya ve Laboratuvar Yönetimi Kursları Yaz Dönemi Başlıyor! : DNA izolasyonu, Primer tasarımı, PCR Teknikleri, Agaroz Jel Elektroforezi,

Detaylı

Kanatlı. Bacillus Amyloliquefaciens in Enzim Aktivitesi

Kanatlı. Bacillus Amyloliquefaciens in Enzim Aktivitesi Bacillus Amyloliquefaciens in Enzim Aktivitesi KONU Bacillus amyloliquefaciens in enzim aktivitesi İLGİ Probiyotik türü olan Bacillus amyloliquefaciens in enzim aktivitesi üzerine yapılan değerlendirme

Detaylı

T.C. ANKARA ÜNİVERSİTESİ BİYOTEKNOLOJİ ENSTİTÜSÜ YÜKSEK LİSANS TEZİ

T.C. ANKARA ÜNİVERSİTESİ BİYOTEKNOLOJİ ENSTİTÜSÜ YÜKSEK LİSANS TEZİ T.C. ANKARA ÜNİVERSİTESİ BİYOTEKNOLOJİ ENSTİTÜSÜ YÜKSEK LİSANS TEZİ TÜRKİYE NİN DEĞİŞİK BÖLGELERİNDEN TERMOSTABİL ALFA AMİLAZ ÜRETEN Bacillus sp. TÜRLERİNİN İZOLASYONU KARAKTERİZASYONU VE ALFA AMİLAZ GENİNİN

Detaylı

Merve ŞAHİNTÜRK Prof. Dr. Zübeyde ÖNER Süleyman Demirel Üniversitesi Mühendislik Fakültesi Gıda Mühendisliği Bölümü

Merve ŞAHİNTÜRK Prof. Dr. Zübeyde ÖNER Süleyman Demirel Üniversitesi Mühendislik Fakültesi Gıda Mühendisliği Bölümü Merve ŞAHİNTÜRK Prof. Dr. Zübeyde ÖNER Süleyman Demirel Üniversitesi Mühendislik Fakültesi Gıda Mühendisliği Bölümü Kimyasal bileşiminin anne sütüne benzerlik göstermesi Temel besin ögeleri açısından zengin

Detaylı

ADIM ADIM YGS- LYS 92. ADIM KALITIM 18 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI

ADIM ADIM YGS- LYS 92. ADIM KALITIM 18 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI ADIM ADIM YGS- LYS 92. ADIM KALITIM 18 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI GENETİK MÜHENDİSLİĞİ Belirli bir amaca yönelik olarak genetik madde üzerinde yapılan çalışmaları içerir. Canlıların

Detaylı

FEN ve TEKNOLOJİ / GENETİK MÜHENDİSLİĞİ ve BİYOTEKNOLOJİ. GENETİK MÜHENDİSLİĞİ ve BİYOTEKNOLOJİ

FEN ve TEKNOLOJİ / GENETİK MÜHENDİSLİĞİ ve BİYOTEKNOLOJİ. GENETİK MÜHENDİSLİĞİ ve BİYOTEKNOLOJİ GENETİK MÜHENDİSLİĞİ ve BİYOTEKNOLOJİ 1 Genetik mühendisliği canlıların kalıtsal özelliklerinin değiştirilerek onlara yeni işlevler kazandırılmasına yönelik araştırmalar yapan bilim dalıdır. Genetik mühendisleri

Detaylı

PCR Bir reaksiyonun kurulması ve optimize edilmesi

PCR Bir reaksiyonun kurulması ve optimize edilmesi Hafta V PCR Temelli Genetik Analiz Yaklaşımları PCR Bir reaksiyonun kurulması ve optimize edilmesi Doç. Dr. Hilâl Özdağ F Đ Z Đ K Đ A L T Y A P I Reaksiyonda kullanılanlar: P C R I. Kalıp DNA a) PCR degrade

Detaylı

Genetik Bilgi: DNA Yapısı, Fonksiyonu ve Replikasyonu. Dr. Mahmut Çerkez Ergören

Genetik Bilgi: DNA Yapısı, Fonksiyonu ve Replikasyonu. Dr. Mahmut Çerkez Ergören Genetik Bilgi: DNA Yapısı, Fonksiyonu ve Replikasyonu Dr. Mahmut Çerkez Ergören Genetik materyal; Kendini çoğaltır. Bilgi depolar. Bilgiyi ifade eder. Mutasyonla varyasyonlara izin verir. Genetik Tarihçe

Detaylı

Tarımsal Biyoteknolojiye Giriş

Tarımsal Biyoteknolojiye Giriş Tarımsal Biyoteknolojiye Giriş Adnan Menderes Üniversitesi Tarımsal Biyoteknoloji TAB 101 Muavviz Ayvaz (Yrd. Doç. Dr.) 12. Hafta (03.12.2013) 1 Genetiği Değiştirilmiş Organizmalar (GDO) 2 Genetik: Biyolojinin

Detaylı

Laboratuvar Tekniği. Adnan Menderes Üniversitesi Tarımsal Biyoteknoloji Bölümü TBY 118 Muavviz Ayvaz (Yrd. Doç. Dr.) 8. Hafta (04.04.

Laboratuvar Tekniği. Adnan Menderes Üniversitesi Tarımsal Biyoteknoloji Bölümü TBY 118 Muavviz Ayvaz (Yrd. Doç. Dr.) 8. Hafta (04.04. Laboratuvar Tekniği Adnan Menderes Üniversitesi Tarımsal Biyoteknoloji TBY 118 Muavviz Ayvaz (Yrd. Doç. Dr.) 8. Hafta (04.04.2014) 1 6. Haftanın Ders İçeriği Bazı Temel Kavramlar Şekerlerin Tayini Enzimlerin

Detaylı

PROTEİNLER. -Proteinlerin Yapısında Bulunan Elementler. -Aminoasitler. --Kimyasal Yapılarına Göre Amino Asitlerin Sınıflandırılması

PROTEİNLER. -Proteinlerin Yapısında Bulunan Elementler. -Aminoasitler. --Kimyasal Yapılarına Göre Amino Asitlerin Sınıflandırılması PROTEİNLER -Proteinlerin Yapısında Bulunan Elementler -Aminoasitler --Kimyasal Yapılarına Göre Amino Asitlerin Sınıflandırılması - Esansiyel olan veya olmayan amino asitler -Proteinlerin Kimyasal Özellikleri

Detaylı

STERİLİZASYON. Sterilizasyon Yöntemleri. Sterilizasyonu Etkileyen Faktörler

STERİLİZASYON. Sterilizasyon Yöntemleri. Sterilizasyonu Etkileyen Faktörler STERİLİZASYON Tüm canlı mikroorganizmaların tam olarak uzaklaştırılması veya öldürülmesi işlemidir. Türk Gıda Kodeksi Çiğ Süt ve Isıl İşlem Görmüş Sütleri Tebliği ne göre sterilizasyon; oda sıcaklığında

Detaylı

Mikrobiyal Gelişim. Jenerasyon süresi. Bakterilerde üreme eğrisi. Örneğin; (optimum koşullar altında) 10/5/2015

Mikrobiyal Gelişim. Jenerasyon süresi. Bakterilerde üreme eğrisi. Örneğin; (optimum koşullar altında) 10/5/2015 Mikrobiyal Gelişim Tek hücreli organizmalarda sayı artışı Bakterilerde en çok görülen üreme şekli ikiye bölünmedir (mikroorganizma sayısı) Çok hücreli organizmalarda kütle artışı Genelde funguslarda görülen

Detaylı

BAKTERİLERDE EKSTRAKROMOZAL GENETİK ELEMENTLER

BAKTERİLERDE EKSTRAKROMOZAL GENETİK ELEMENTLER BAKTERİLERDE EKSTRAKROMOZAL GENETİK ELEMENTLER Plazmid ve Epizomlar Bakterilerin kendi kromozomlarının yanı sıra, kromozom dışı bazı genetik parçacıklar bulunmaktadır Bakteri kromozomundan daha küçük yapıda

Detaylı

Replikasyon, Transkripsiyon ve Translasyon. Yrd. Doç. Dr. Osman İBİŞ

Replikasyon, Transkripsiyon ve Translasyon. Yrd. Doç. Dr. Osman İBİŞ Replikasyon, Transkripsiyon ve Translasyon Yrd. Doç. Dr. Osman İBİŞ DNA replikasyonu DNA nın replikasyonu, DNA molekülünün, sakladığı genetik bilgilerin sonraki nesillere aktarılması için kendi kopyasını

Detaylı

GIDA ENDÜSTRİSİNDE SOYA KAYNAKLI PROTEİNLERE ALTERNATİF ARAYIŞLARI

GIDA ENDÜSTRİSİNDE SOYA KAYNAKLI PROTEİNLERE ALTERNATİF ARAYIŞLARI GIDA ENDÜSTRİSİNDE SOYA KAYNAKLI PROTEİNLERE ALTERNATİF ARAYIŞLARI Yrd. Doç. Dr. Levent Yurdaer AYDEMİR Adana Bilim ve Teknoloji Üniversitesi Gıda Mühendisliği 05-07 Ekim 2016, EDİRNE Pazar büyüklüğü:

Detaylı

HUBUBAT TEKNOLOJİSİ 26.02.2013. Buğday danesinin kimyasal yapısı: Buğday danesinde bulunan su miktarı,

HUBUBAT TEKNOLOJİSİ 26.02.2013. Buğday danesinin kimyasal yapısı: Buğday danesinde bulunan su miktarı, HUBUBAT TEKNOLOJİSİ Buğday danesinin kimyasal yapısı: 1. Karbonhidratlar (Mono, oligo ve polisakkaritler) 2. Kompleks karbonhidratlar (Pentozanlar, Hemiselüloz, Selüloz) 3. Azotlu maddeler (Proteinler

Detaylı

RASYON TANIM, KİMYASAL BİLEŞİM, VE RASYON HAZIRLAMA PROF. DR. AHMET ALÇİÇEK EGE ÜNİVERSİTESİ ZİRAAT FAKÜLTESİ

RASYON TANIM, KİMYASAL BİLEŞİM, VE RASYON HAZIRLAMA PROF. DR. AHMET ALÇİÇEK EGE ÜNİVERSİTESİ ZİRAAT FAKÜLTESİ RASYON TANIM, KİMYASAL BİLEŞİM, VE RASYON HAZIRLAMA PROF. DR. AHMET ALÇİÇEK EGE ÜNİVERSİTESİ ZİRAAT FAKÜLTESİ (Bağırsaklar) (Kırkbayır) (Yemek borusu) (İşkembe) (Şirden) (Börkenek) Yemin Süt Sığırı Midelerinde

Detaylı

TÜBİTAK MAM GEN MÜHENDM HENDİSLİĞİ VE BİYOTEKNOLOJB YOTEKNOLOJİ ENSTİTÜSÜ (GMBE) TANITIMI IKEV Türkiye için Biyoteknoloji Toplantısı 8 Kasım m 2007 1 GMBE Personeli Araştırmacı 50 Toplam Personel 65 Teknisyen

Detaylı

Modern Bitki Biyoteknolojisi

Modern Bitki Biyoteknolojisi Modern Bitki Biyoteknolojisi Ali TETİK Eylül, 2001 AJANDA: Biyoteknoloji Nedir? Biyoteknolojinin Genel Kullanım Alanları Bitki Islahında Biyoteknoloji ve Gen Tekniği Biyoteknoloji ile Yeni Bitkilerin elde

Detaylı

6. BÖLÜM MİKROBİYAL METABOLİZMA

6. BÖLÜM MİKROBİYAL METABOLİZMA 6. BÖLÜM MİKROBİYAL METABOLİZMA 1 METABOLİZMA Hücrede meydana gelen tüm reaksiyonlara denir Anabolizma: Basit moleküllerden kompleks moleküllerin sentezlendiği enerji gerektiren reaksiyonlardır X+Y+ENERJİ

Detaylı

Can boğazdan gelir.. Deveyi yardan uçuran bir tutam ottur..

Can boğazdan gelir.. Deveyi yardan uçuran bir tutam ottur.. Can boğazdan gelir.. Deveyi yardan uçuran bir tutam ottur.. 1 BESLENME BİLİMİ 2 Yaşamımız süresince yaklaşık 60 ton besin tüketiyoruz. Besinler sağlığımız ve canlılığımızın devamını sağlar. Sağlıklı bir

Detaylı

Asidik suyun özellikleri. Alkali suyun özellikleri. ph > 11 ORP < -800mV Cl içermez. ph < 2,7 ORP < 1100mV Cl derişimi: 10-80 ppm

Asidik suyun özellikleri. Alkali suyun özellikleri. ph > 11 ORP < -800mV Cl içermez. ph < 2,7 ORP < 1100mV Cl derişimi: 10-80 ppm Et Endüstrisinde Elektrolize Yükseltgen Su Uygulaması Cem Okan ÖZER, Birol KILIÇ SÜLEYMAN DEMİREL ÜNİVERSİTESİ GIDA MÜHENDİSLİĞİ Elektrolize yükseltgen su Kontaminasyon=problem Bakteriler otostopçudur.

Detaylı

3.1. Karbonhidratların Tanımı 3.2. Karbonhidratların Sınıflandırılması 3.3. Monosakkaritler ve Monosakkarit Türevleri Monosakkaritler

3.1. Karbonhidratların Tanımı 3.2. Karbonhidratların Sınıflandırılması 3.3. Monosakkaritler ve Monosakkarit Türevleri Monosakkaritler 3.1. Karbonhidratların Tanımı 3.2. Karbonhidratların Sınıflandırılması 3.3. Monosakkaritler ve Monosakkarit Türevleri 3.3.1. Monosakkaritler 3.3.1.1. Monosakkaritlerin isimlendirilmesi 3.3.2. Monosakkaritlerin

Detaylı

NIRLINE. NIRLINE ile Ham Maddelerinizde Yağ Asidi Tayini, Sürdürülebilir Besleme ile Sizi Geleceğe Taşır!

NIRLINE. NIRLINE ile Ham Maddelerinizde Yağ Asidi Tayini, Sürdürülebilir Besleme ile Sizi Geleceğe Taşır! ile Ham Maddelerinizde Yağ Asidi Tayini, Sürdürülebilir Besleme ile Sizi Geleceğe Taşır! KONU Yağ Asidi Profillerinin Hayvan Beslemedeki Önemi ve Analizleri İLGİ ile Ham Maddelerinizde Yağ Asidi Tayini,

Detaylı

YAZILIYA HAZIRLIK SORULARI. 9. Sınıf 2 KARBONHİDRAT LİPİT (YAĞ)

YAZILIYA HAZIRLIK SORULARI. 9. Sınıf 2 KARBONHİDRAT LİPİT (YAĞ) YAZILIYA HAZIRLIK SORULARI 9. Sınıf 2 KARBONHİDRAT LİPİT (YAĞ) DOĞRU YANLIŞ SORULARI Depo yağlar iç organları basınç ve darbelerden korur. Steroitler hücre zarının yapısına katılır ve geçirgenliğini artırır.

Detaylı

Hücre çeperi (Hücre duvarı)

Hücre çeperi (Hücre duvarı) Hücre çeperi (Hücre duvarı) Mycoplasmalar dışındaki tüm prokaryotlarda vardır. Görevleri: Bakteriyi kendi iç basıncına karşı korur(hücre içi ozmotik basıncı % 10-20 sakkaroz çözeltisi yoğunluğuna eşittir).

Detaylı

Bacillus anthracis. Hayvanlarda şarbon etkenidir. Bacillus anthracis. Gram boyama. Bacillus anthracis. Bacillus anthracis

Bacillus anthracis. Hayvanlarda şarbon etkenidir. Bacillus anthracis. Gram boyama. Bacillus anthracis. Bacillus anthracis Bacillus anthracis Gram pozitif, obligat aerop sporlu, çomak şeklinde bakterilerdir. 1µm eninde, 2-4 µm uzunluğunda, konkav sonlanan, kirpiksiz bakterilerdir. Bacillus anthracis in doğal yaşam ortamı topraktır.

Detaylı

EVDE BİYOTEKNOLOJİ. Yrd. Doç. Dr. Hüseyin UYSAL ADNAN MENDERES ÜNİVERSİTESİ TARIMSAL BİYOTEKNOLOJİ BÖLÜMÜ 5. DERS

EVDE BİYOTEKNOLOJİ. Yrd. Doç. Dr. Hüseyin UYSAL ADNAN MENDERES ÜNİVERSİTESİ TARIMSAL BİYOTEKNOLOJİ BÖLÜMÜ 5. DERS EVDE BİYOTEKNOLOJİ Yrd. Doç. Dr. Hüseyin UYSAL ADNAN MENDERES ÜNİVERSİTESİ TARIMSAL BİYOTEKNOLOJİ BÖLÜMÜ 5. DERS STERİLİZASYON; BİTKİ DOKU KÜLTÜRLERİNDE KULLANILAN STERİLİZASYON YÖNTEMLERİ VE BU STERİLİZASYON

Detaylı

Ege Sahil Kuşağına Uygun Kavuzsuz Yulaf Çeşidinin Geliştirilmesi Beslenme Yaklaşımı

Ege Sahil Kuşağına Uygun Kavuzsuz Yulaf Çeşidinin Geliştirilmesi Beslenme Yaklaşımı Ege Sahil Kuşağına Uygun Kavuzsuz Yulaf Çeşidinin Geliştirilmesi Beslenme Yaklaşımı 07.10.2016 Özge YILDIZ Gıda Yük. Müh. Aydın İMAMOĞLU, Seda PELİT Ege Tarımsal Araştırma Enstitüsü Müdürlüğü İzmir Proje:

Detaylı

POLİMERAZ ZİNCİR REAKSİYONU (PZR-PCR) VE RESTRİKSİYON PARÇA UZUNLUĞU POLİMORFİZMİ (RFLP)

POLİMERAZ ZİNCİR REAKSİYONU (PZR-PCR) VE RESTRİKSİYON PARÇA UZUNLUĞU POLİMORFİZMİ (RFLP) Deney: M 1 POLİMERAZ ZİNCİR REAKSİYONU (PZR-PCR) VE RESTRİKSİYON PARÇA UZUNLUĞU POLİMORFİZMİ (RFLP) a) PCR yöntemi uygulaması b) RPLF sonuçları değerlendirilmesi I. Araç ve Gereç dntp (deoksi Nükleotid

Detaylı

LYS BÝYOLOJÝ. Biyolojiye Giriþ ve Bilimsel Yöntem Canlýlarýn Temel Bileþenleri Enzimler Canlýlarýn Sýnýflandýrýlmasý

LYS BÝYOLOJÝ. Biyolojiye Giriþ ve Bilimsel Yöntem Canlýlarýn Temel Bileþenleri Enzimler Canlýlarýn Sýnýflandýrýlmasý LYS BÝYOLOJÝ Soru Çözüm Dersi Kitapçığı 1 (MF) Biyolojiye Giriþ ve Bilimsel Yöntem Canlýlarýn Temel Bileþenleri Enzimler Canlýlarýn Sýnýflandýrýlmasý Bu yayýnýn her hakký saklýdýr. Tüm haklarý bry Birey

Detaylı

Mardin İlinde Üretilen Mısır Nişastasının Spesifikasyon Değerlerine Uygunluğunun Belirlenmesi - doi: 10.17932/ IAU.

Mardin İlinde Üretilen Mısır Nişastasının Spesifikasyon Değerlerine Uygunluğunun Belirlenmesi - doi: 10.17932/ IAU. Mardin İlinde Üretilen Mısır Nişastasının Spesifikasyon Değerlerine Uygunluğunun Belirlenmesi - doi: 10.17932/ IAU. IAUD.m.13091352.2015.7/25.13-17 Nurten BOZDEMİR 1 Murat ÇİMEN 1* Seyhan AKÇAN 1 Özet

Detaylı

Akreditasyon Sertifikası Eki (Sayfa 1/5) Akreditasyon Kapsamı

Akreditasyon Sertifikası Eki (Sayfa 1/5) Akreditasyon Kapsamı Akreditasyon Sertifikası Eki (Sayfa 1/5) Uzman Kalite Eğitim Danışmanlık Ve Laboratuvar Hizmetleri Ltd.şti Deney Laboratuvarı Akreditasyon No: Adresi :Mecidiye mah. Bestekar Şevki bey, Sok 32, Balmumcu

Detaylı

Bornova Vet.Kont.Arst.Enst.

Bornova Vet.Kont.Arst.Enst. Yemlerde Amino asitler ve B Grubu Vitaminlerinin Önemi ve Test Metotları Süreyya ÖZCAN Besin Öğeleri Canlının yaşamını devam ettirmesi için gerekli olan kimyasal element veya bileşiklerdir. Hücrelerin

Detaylı

ENDÜSTRİYEL BİYOTEKNOLOJİ

ENDÜSTRİYEL BİYOTEKNOLOJİ ENDÜSTRİYEL BİYOTEKNOLOJİ Prof. Fazilet VARDAR SUKAN EBİLTEM 3 Nisan 2013, Ankara Tanımlar Biyoteknoloji Biyoekonomi Giriş Endüstriyel Biyoteknoloji sınırları, ürünlerin niteliği ve hangi sektöre hizmet

Detaylı

KANATLI HAYVAN BESLEME (Teorik Temel-Pratik Uygulama)

KANATLI HAYVAN BESLEME (Teorik Temel-Pratik Uygulama) KANATLI HAYVAN BESLEME (Teorik Temel-Pratik Uygulama) -Ders Notu- Çukurova Üniversitesi Ziraat Fakültesi Zootekni Bölümü Yemler ve Hayvan Besleme Anabilim Dalı Adana ADANA-2008 ÖNSÖZ Hayvan beslemenin

Detaylı

Yemlerde Amino asitler ve B Grubu Vitaminlerinin Önemi ve Test Metotları. Süreyya ÖZCAN

Yemlerde Amino asitler ve B Grubu Vitaminlerinin Önemi ve Test Metotları. Süreyya ÖZCAN Yemlerde Amino asitler ve B Grubu Vitaminlerinin Önemi ve Test Metotları Süreyya ÖZCAN Besin Öğeleri Canlının yaşamını devam ettirmesi için gerekli olan kimyasal element veya bileşiklerdir. Hücrelerin

Detaylı

Spor alanında beslenme ile ilgili bilgileri bu ünite kapsamında sizlere vereceğiz. Ünite içeriğinde yer alan teorik bilgi ve sizlerin

Spor alanında beslenme ile ilgili bilgileri bu ünite kapsamında sizlere vereceğiz. Ünite içeriğinde yer alan teorik bilgi ve sizlerin 1 Giriş Spor alanında beslenme ile ilgili bilgileri bu ünite kapsamında sizlere vereceğiz. Ünite içeriğinde yer alan teorik bilgi ve sizlerin tamamlayacağı yazılı, sözlü ve uygulamalı görevler beslenme,

Detaylı

RUMİNANT RASYONLARINDA MAYA KULLANIMI VE ÖNEMİ

RUMİNANT RASYONLARINDA MAYA KULLANIMI VE ÖNEMİ RUMİNANT RASYONLARINDA MAYA KULLANIMI VE ÖNEMİ Rumen mikroorganizmaların (bakteriler,protozoalar ve mayaların) bir denge içinde çalıştırdığı kusursuz bir makinedir. Yüksek et-süt verimi isterken bu hayvandaki

Detaylı

THERMOFİL BACILLUS SP. DEN ALKALİN, TERMOFİLİK, OKSİDANT DİRENÇLİ, SELÜLAZ ÜRETİMİ VE KARAKTERİZASYONU*

THERMOFİL BACILLUS SP. DEN ALKALİN, TERMOFİLİK, OKSİDANT DİRENÇLİ, SELÜLAZ ÜRETİMİ VE KARAKTERİZASYONU* THERMOFİL BACILLUS SP. DEN ALKALİN, TERMOFİLİK, OKSİDANT DİRENÇLİ, SELÜLAZ ÜRETİMİ VE KARAKTERİZASYONU* Production and Characterzation of Alkaline, Thermophilic, Highly Thermostabil and Oxsidant Resistant

Detaylı

GEN KLONLAMASI. copyright cmassengale

GEN KLONLAMASI. copyright cmassengale GEN KLONLAMASI copyright cmassengale 1 Klonlama nedir? Bir genin vekto re yerleştirilmesi ve bu vekto ru n bakteri hu crelerine transformasyonu sonucunda hu crelerin bo lu nmesi sırasında vekto ru n de

Detaylı

RASYON ÇÖZÜMÜNDE TEMEL KRİTERLER

RASYON ÇÖZÜMÜNDE TEMEL KRİTERLER RASYON ÇÖZÜMÜNDE TEMEL KRİTERLER KAFES YUMURTA TAVUĞU RASYONU Ca % P % Ver. Mik.% HP Yem Mad. HP % ME kcal/kg % ME kcal/kg Ca % P % Mısır 8 3400 0,05 0,3 52,00 4,16 1768,00 0,026 0,156 Arpa 11 2650 0,07

Detaylı

TOPRAK TOPRAK TEKSTÜRÜ (BÜNYESİ)

TOPRAK TOPRAK TEKSTÜRÜ (BÜNYESİ) TOPRAK Toprak esas itibarı ile uzun yılların ürünü olan, kayaların ve organik maddelerin türlü çaptaki ayrışma ürünlerinden meydana gelen, içinde geniş bir canlılar âlemini barındırarak bitkilere durak

Detaylı

ORGANİK BİLEŞİKLER Karbon Dünyası

ORGANİK BİLEŞİKLER Karbon Dünyası ORGANİK BİLEŞİKLER Canlı Organizmalarda bulunan büyük ve karışık yapılı moleküller yani makromoleküllerdir Makromoleküllerin hepsinde karbon vardır. Karbon Dünyası Makromoleküller birbirlerine kovalent

Detaylı

Ürün Parametre Örnek Aralık (%) R Örnek Hazırlama. Ürün Parametre Örnek Aralık (%) R Örnek Hazırlama

Ürün Parametre Örnek Aralık (%) R Örnek Hazırlama. Ürün Parametre Örnek Aralık (%) R Örnek Hazırlama DA 7250 Yem Kalibrasyon Paketi DA 7250 yem endüstrisinde yaygın olarak kullanılmaktadır. Hassasiyeti, hızı ve esnekliği sayesinde yem hammeddleri ve mamül yemlerde çalışmaya uygundur. Bu kalibrasyon paketi

Detaylı

A. Tahıl ve Tahıl Ürünlerinin Sınıflandırılması B. Mikrobiyel Bozulmalar C. Depolama Koşulları

A. Tahıl ve Tahıl Ürünlerinin Sınıflandırılması B. Mikrobiyel Bozulmalar C. Depolama Koşulları A. Tahıl ve Tahıl Ürünlerinin Sınıflandırılması B. Mikrobiyel Bozulmalar C. Depolama Koşulları TAHIL ve TAHIL ÜRÜNLERİNİN SINIFLANDIRILMASI Tahıl, Graminiae familyasının tohumları olan buğday, çavdar,

Detaylı

ayxmaz/biyoloji Adı: 1.Aşağıda verilen atomların bağ yapma sayılarını (H) ekleyerek gösterin. C N O H

ayxmaz/biyoloji Adı: 1.Aşağıda verilen atomların bağ yapma sayılarını (H) ekleyerek gösterin. C N O H Adı: 1.Aşağıda verilen atomların bağ yapma sayılarını (H) ekleyerek gösterin. C N O H 2.Radyoaktif izotoplar biyologları için önemlidir? Aşağıda radyoakif maddelerin kullanıldığı alanlar sıralanmıştır.bunlarla

Detaylı

GIDA MÜHENDİSLİĞİ BÖLÜMÜ

GIDA MÜHENDİSLİĞİ BÖLÜMÜ GIDA MÜHENDİSLİĞİ BÖLÜMÜ YAPILAN ÇALIŞMALAR ANALİZLER 1.1 GENEL ANALİZLER 1. KİMYASAL ANALİZLER kodu GM1101 Nem tayini Etüv yöntemi GM1102 Kül tayini Fırın yöntemi kuru yakma GM1103 Protein tayini Kjeldahl

Detaylı

10. SINIF KONU ANLATIMI 37 KALITIM 18 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI

10. SINIF KONU ANLATIMI 37 KALITIM 18 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI 10. SINIF KONU ANLATIMI 37 KALITIM 18 GENETİK MÜHENDİSLİĞİ VE BİYOTEKNOLOJİ ÇALIŞMA ALANLARI GENETİK MÜHENDİSLİĞİ Belirli bir amaca yönelik olarak genetik madde üzerinde yapılan çalışmaları içerir. Canlıların

Detaylı

Gen Mühendisliği ve klonlama

Gen Mühendisliği ve klonlama Gen Mühendisliği ve klonlama Moleküler biyologlar, canlı hücredeki moleküllerin, hücre yapısı ve fonksiyonuna nasıl katıldıklarını anlamak isterler. Proteinler hücrenin yapı taşlarını oluştururlar ve bunlar

Detaylı

Bitki Kökenli Rekombinant Proteinlerin Geri Kazanımı ve Saflaştırılması

Bitki Kökenli Rekombinant Proteinlerin Geri Kazanımı ve Saflaştırılması Bitki Kökenli Rekombinant Proteinlerin Geri Kazanımı ve Saflaştırılması Araş. Gör. Alp Ayan T.C. İstanbul Kültür Üniversitesi, 2011 1 Günümüzde üretilen bitkisel kökenli rekombinant proteinler; İnsan terapötikleri

Detaylı

MİKROBİYOLOJİ SORU KAMPI 2015

MİKROBİYOLOJİ SORU KAMPI 2015 Canlıların prokaryot ve ökoaryot olma özelliğini hücre komponentlerinden hangisi belirler? MİKROBİYOLOJİ SORU KAMPI 2015 B. Stoplazmik membran C. Golgi membranı D. Nükleer membran E. Endoplazmik retikulum

Detaylı

7. BÖLÜM MİKROBİYAL GELİŞİM

7. BÖLÜM MİKROBİYAL GELİŞİM 7. BÖLÜM MİKROBİYAL GELİŞİM 1 Gelişim Tek hücreli organizmalarda sayı artışı Bakterilerde en çok görülen üreme şekli ikiye bölünmedir (mikroorganizma sayısı) Çok hücreli organizmalarda kütle artışı Genelde

Detaylı

2. Histon olmayan kromozomal proteinler

2. Histon olmayan kromozomal proteinler 12. Hafta: Nükleik Asitler: Nükleik asitlerin yapısal üniteleri, nükleozitler, nükleotidler, inorganik fosfat, nükleotidlerin fonksiyonları, nükleik asitler, polinükleotidler, DNA nın primer ve sekonder

Detaylı

YEM VE DİĞER TARLA BİTKİLERİ

YEM VE DİĞER TARLA BİTKİLERİ 21-22 Nisan 2015 / İZMİR YEM VE DİĞER TARLA BİTKİLERİ KANATLI HAYVAN BESLEMEDE DUT YAPRAĞI TOZU VE DUT YAPRAĞI SİLAJI TOZUNUN HAYVAN PERFORMANSI, SERUM PARAMETRELERİ, ET KALİTESİ VE YEM MALİYETİ ÜZERİNE

Detaylı

BRCA 1/2 DNA Analiz Paneli

BRCA 1/2 DNA Analiz Paneli FAST-BRCA Sequencing Kit BRCA 1/2 DNA Analiz Paneli Dizi Analizi Amaçlı Kullanım İçin KULLANIM KILAVUZU İÇİNDEKİLER 1 GİRİŞ... 3 2 KİT İÇERİĞİ... 3 3 SAKLAMA... 3 4 GEREKLİ MATERYAL VE CİHAZLAR... 3 5

Detaylı