Önce oyunun kurallarını öğrenmek zorundasınız. Sonra da herkesten iyi oynamayı... Einstein

Ebat: px
Şu sayfadan göstermeyi başlat:

Download "Önce oyunun kurallarını öğrenmek zorundasınız. Sonra da herkesten iyi oynamayı... Einstein"

Transkript

1 abou.to/mmtopkaya Önce oyunun kurallarını öğrenmek zorundasınız. Sonra da herkesten iyi oynamayı... Einstein

2 Ben sosyal ağ kuracak olsaydım eğer, bu konuda bana danışırdım. Bende bu konuda bana danışan bana, aşağıdaki talimatnameyi verirdim. Talimatname 4 bölümden oluşurdu. Milattan önce, milat günü, milattan sonra ve her zaman için. Bu talimatname kibar görünmeyebilir. Ama Albert* in de dediği gibi: Gerçeği açıklamak istediğinde, zerafeti terziye bırak. *Albert Einstein

3 Milattan Önce Sosyal ağın en önemli parçası kullanıcılardır. Kullanıcı yoksa, diğer şeylerin anlamı kalmaz Önce talep toplayıp açılışı ertelerken aynı zamanda projeyi geliştirebileceğin bir zamanın olmuş olacak. Google+ a bak. En büyük sorunu neredeyse kimse olmaması. Olanlarda bir şey yapmıyor. -Ön talep toplama. Profilleri detaylandırma, ilişkilendirme. Kullanıcı çeşitliliğini artırma. *Ön kayıt toplarken e-posta adresi aldığın sayfada facebook beğen tuşu olsun. Bu sayede facebook reklam seçeneklerini kullanarak ağa katılanların arkadaşlarını çekebilirsin. Facebook ve Twitter için uygulama da tasarlayabilirsin.

4 *Geniş bir bölgeden seyrek kullanıcılar toplamak yerine dar alanlara yoğunlaş. Bu sayede insanlar sitede sosyal kalabilirler. Facebook böyle başlamıştı. -Firmalar için sosyal medya kullanım rehberleri hazırla, dağıt. Neler yapabileceklerini ve nelerden kaçınmaları gerektiğini anlatabilirsin. Bunu ünlüler içinde yapabilirsin. Ayrıca bunlar için profil oluşturmaya ve tasarlamaya yardımcı ekipler kurabilirsin. -Nasıl kullanıcılar: Zeki, katılımcı, eğlenceli, paylaşımcı. *Fırsatçıları uzak tut. -Sitene çekici insanları toplamak için para harca. -Paranın yüzde 75 ini zeki ve çekici kadınları, yüde 25 ini erkekleri çekmek için harca. Kadınlar geldiğinde erkekler gelecektir. Burada zeka unsurunu atlama. O olmazsa, ortam iyi olmaz. ***Bunu yapmak kendini kötü hissetmene sebep olabilir. -Logonu en iyi şekilde yaptır.

5 -Dil bilgisi testi. *Sesi dinle, yaz. -Zeka testi. -Teknoloji aşinalığı. Seviye Tespit Sistemi İle Kullanıcıları Ölç *Örnek gizlilik ayarı: Gönderilerimi sadece zekiler takip edebilir. Dilbilgisi iyi olanlar yorum yapabilir. Toplumda insanların önem verdiği kişileri (sanatçılar, yazarlar, muhabirler, kanaat önderleri) sosyal ağına katılmaya ikna et.

6 Tasarım Konusu -Ünlü ve çok kullanılan siteleri al, incele ama KARIŞTIRMA -Değişimlerin gitme yönlerini izle, AKINTIYA ODAKLAN -Diğerlerinin yanlışlarından ders al, KAYALIKLARDA PARÇALANMA -Sade ve basit ol, KARMAŞIKLAŞTIRMA, ama çok basit değil. -Özellikleri kademe kademe aç, kullanıcıyı alıştır. -TEST ET, TEST ET, TEST ET. -Bir parça özelleştirilebilir ol. -Erişilebilir ol. -Evrensel ol. -Uyumlu ol. -Akıcı ol.

7 -Paylaşmaya, üretmeye, tüketmeye Teşvik edici ol. -Hızlı ol. *Hız konusunda ideal ol. Çok hızlı olman uçarı, çok yavaş olman hantal bir site gibi görünmene sebep olabilir. -Ziyaretçiyi sitede tutmaya odaklan. Çıkış düşmesini el altından kaldır. *Çıkış için tıklandığında küçük bir gerisayım başlat. İptal e basılırsa ilgi çekici içeriklerin olduğu bir sayfaya yönlendir. (Çıkıyorsunuz İptal) *Ağda paylaşılan bağlantıların karakterlerini say. Adresin ilk yarısına tıklıyorsa site önemlidir, dışarda aç. İkinci yarıya tıklıyorsa içerde aç. Facebook ta fotoğraf açar gibi. Ayrıca yan taraflara paylaş gibi düşmeler koy. (örnek adres hürriyet.com.tr/haberler/soyle-boyle-oldu-haberi). *İnterneti içeri aktarabilirsin. Kullanıcılar sık kullandıkları sitelere (haber siteleri gibi) ağ içinden erişebilsin. Hem dışarı çıkmamış olur, hemde koyacağın ağda paylaş gibi özelliklerle ağa içerik sağlamış olursun.

8 -Siteyi, markayı çok fazla ön plana çıkarma. Çıkarsanda kullanım süresi arttıkça geri çekil. *Arayüzün her tür insana tek bir şekilde hitap etmek zorunda değil. Farklı zihinsel tipler için farklı arayüzler sunabilirsin. Arayüzün kullanıldıkça özelleşebilir. Bunun için yapacağın Seviye Tespit Testlerini ve istatistikleri, ayrıca tabii ki teknolojiyi kullanabilirsin. -Kullanım rehberleri hazırlama, onun yerine daha fazla kullanıcı çek. Anlayanlar anlamayanlara anlatsın. Bu da yine daha fazla kullanıcı çekecek. Kullanım rehberine ihtiyaç varsa tasarım konusunu bir daha oku. -Engelliler ve yaşlılar için özel arayüzler tasarla. Onların kullandıkları yazılımlarla test et siteni.

9 -Mobil cihazlar için uygulamalar hazırla. Cihaz kaplama rengi, ekran boyutu gibi farklılıklara göre özelleşmiş arayüzler. *Cihaz pil durumuna göre özelliklerin hafifletilmesi, cihaz güçlülüğüne göre özellik filtrelemesi. Mobil cihazlar konusuna çok fazla önem ver. Bu konuya önem vermeye önem ver. Bu konuya verdiğim öneme önem ver.

10 Arayüz Nasıl Olmalıdır? -Kişiye ve karaktere özel (yaş, cinsiyet, sağ beyin-sol beyin ağırlıklı düşünme, zeka). -Tanıdık ve farklı. Biraz tanıdık biraz farklı ol. İnsanların başka sitelerde sık yaptıkları şeyleri sitende benzer şekilde yapabilmelerini sağla. Farklı özellikler için farklı olmaktan korkma. Yaptığın testleri kullanarak yeni özellikleri önce kolay adapte olabileceğini düşündüğün kullanıcılarda test et. -Renkler konusunda test yap. Kişisel olabilirsin. Ana renkleri değil, ara renkleri kullan. Kişiye göre özelleştirilebilir olabilirsin. -Mobil cihazlara önem ver. *Kullanıcılara en çok kullandıkları sosyal ağları sor. İlk etapta o sitelere benzer arayüzlerle başlayabilirsin.

11 ***Uygulama geliştiricilerle işbirlikleri yap. Yarışmalar başlat. Popüler uygulamaların sende de olmasını sağla. *Takiplen Login özelliği. Haber siteleri gibi sitelerde yorum bölümlerinde gerçek kişi isimleri ile yer alacağından hem yorum kalitesini artırmak bakımından sitelerin ilgisini çeker. Hemde ağa içerik sağlanır. -Sitelere takiple butonu koyarak açılıştan önce bir miktar içeriğin oluşmasını sağla. Bunu nasıl karşılayacağını ilerde anlatıcam. *Bazı fonksiyonlar ve görünüm özellikleri için aç/kapa seçeneği sun. Çok rahatsız olanlar kapatabilsin.

12 Milat Günü -Geniş duyurular yap. Basın bültenleri gönder, haber sitelerinde yer al. Facebook reklamları ver. Önkayıt bilgilerini aldığın kullanıcılara ulaş. *Facebook reklamları verirken geniş bir zamana değil, daha dar bir zaman aralığına odaklan. Aynı kullanıcılara bir gün içinde farklı ama birbirleriyle alaka kurabilecek kadar benzer reklamlarla görün. *Açılıştan önce profilleri doldurtmuş, kullanıcıları ilişkilendirmiş olmalıydın. Ayrıca arkadaşlık bağlarınında açılıştan önce kurulmasını sağla. Fotoğraf felan yüklettir. Sabah gördüğüm bir reklamı öğlende görürsem ilgimi çeker, ama aynı reklamı akşamda görürsem imleci üzerine götürür ve tıklarım. Tereddüt etmem. -Ad Capone -Siteye ilk gelecek kullanıcıları özenle seç. Önce çoğunlukla içerik yükleyenleri, yorumcuları, paylaşımcıları al. Bunları diğer ağlardaki faal kullanıcıların

13 özelliklerini tespit edip, benzer kullanıcılara ulaşabilirsin. Facebook bunun için güzel reklam seçenekleri sunuyor. -Kullanıcıları profil adreslerini facebook, twitter gibi yerlerde paylaşmaları için teşvik et. -Öğrenen tasarım: Kullanıcıların tasarım tercihlerini izle, öğrenmeye bak. Açılış günü kullanıcıya tanıdık gel, ama farklı olduğunu düşündür. Ona da bilgi vererek, özellikleri yavaş yavaş aç ve özgün tasarımına yavaş yavaş evril. İlk günlerde kolay olmaya bak, alışkanlık yarattıkça yavaşça kompleksleşebilirsin. Bunu her kullanıcı için kayıt tarihini ve sitede geçirilen zamanı göz önünde bulundurarak yap. Bunu yaptığını da kullanıcıya söyleki bir şey yokmuş diyip gitmesin, ayrıca bu merak uyandıracak ve sitede zaman geçirmeye teşvik edecektir.

14 Milattan Sonra -Tanıtıma devam et, özellikle gerçek hayatta. *Bunu nasıl yapacağını dergi konusunda göreceksin. -Marketler ile broşürlerinde market sayfa adreslerinin yer alması için anlaş. Onlar burada günlük indirimleri duyurabilirler. Ayrıca stok fazlası gibi durumlarda şube bazında indirimlerde yapabilirler. -İnsanların bekledikleri yerlerde yer al. Bekleme salonları (kuaför, dişçi gibi), market kasaları, otobüs durakları, deniz otobüsleri. Bunlardan bazılarında birazdan bahsedeceğimiz dergi ile bulun. -Tasarım konusunda öğrenmeye, özelleşmeye ve gelişmeye devam et. -Kullanıcı tabanını genişletmeye devam et. Bu işin en önemli kısmı. Aynı zamanda kullanıcı çeşitliliğini artır. Bunu nasıl yapacağını da yine ilerde göreceksin.

15 -Sosyal medya konulu bir kitaba sponsor ol. Bu imajına yardımcı olacak. -Dergi Konusu: Aylık çıkan, Takiplen adlı bir dergi. O ayki sosyal medya konularını işleyecek, içeriğini kullanıcıların paylaşımları oluşturacak, bu kullanıcılar profil fotoğrafları ve isimleri ile yer alacaklar. Bu ağa katılmayı teşvik edecek ve içeriğin kalitesini artıracaktır. Ayrıca yakında konuşulması muhtemel konuları (seçimler veya uefa kupası gibi) önceden haber verebilirsin. Bu dergisi bahsettiğim bekleme noktalarından bazılarına ücretsiz gönder, ayrıca halk kütüphaneleri, okul kütüphaneleri, okul öğretmen odaları, üniversite kafeler gibi yerlere ücretiz gönder. Aynı zamanda satışa da çıkarki kıymeti olsun. Tabletler için felanda e-dergi versiyonunu çıkar. -Gazete ve dergiler ile anlaş. Yeni çıkacak sayıda çıkacak içerikleri, Seviye Tespit Sistemi ile belirlenmiş zeki, bilgili kullanıcılara yorumlattır. Bunlardan seçilenleri belki sadece önemli haberler için gazete ve dergilerde haber altında

16 kullanıcı fotoğrafı ve profil bilgisi ile bastır. Özellikle basılı yayın bir süre önceden hazırlanması açısından uygun. *Köşe yazarları ile anlaşmalar yap. Profillerinde köşe yazılarının paylaşılmasını ve STS ile belirlenmiş zeki kullanıcılarla tartışılmayı sağlayabilirsin. Bir gün önceden basılacak yazının ağda belli kullanıcı kitlesi ile paylaşılıp, yazarın seçeceği birkaç yorumun gazetede yazı altında yer alması sağlanabilir.

17 Her Zaman İçin -Başkalarının ne yaptıklarını izlediğin kadar ne yapmadıklarını da düşün. -Gerisin geriye git. Zamanında piyasada tutmamış fikirleri incele. Tozlu raflarda define haritaları bulabilirsin. -Yeni fikirler için para ödemeye devam et. Eleştiriler içinde para al. Eleştirilerden aldığın para önerilerin masrafını karşılayacaktır. Karşılamazsa da, tek bir iyi fikir, diğer yetersiz fikirleri sübvanse edebilir.

18 Para Kazanma Hakkında -Bir reklam izler misin? (10 kredi kazanacaksın kredi yerine takiplen lirası da diyebilirsin). -Ağda olmayanlara reklam (bir bebeğin mi var? Kaç yaşında, cinsiyeti ne?). -Konum tabanlı ve saate göre reklamlar. Örnek: Öğle yemeği saatinde yakındaki bir kafenin reklamı. -Reklamların kullanıcıları değil, kullanıcıların reklamları seçtiği bir sistem tasarla. Firmalar reklamları içeriklerine göre etiketlesinler. Editörler bunların doğruluğunu kontrol etsin ve kullanıcılar sadece seçtiği etiketlerde reklamlar görsün. Hem böylece kullanıcı reklamı kendisi seçtiği için, tutarlı olmak adına reklama ilgi gösterecek, etkilenmeye daha açık olacaktır.

19 Kredili İçerikler -Dergiler kredili içerik sunabilirler. Giriş bölümü ücretsiz sunulur ve devamını oku düşmesinin maliyeti yanına yazılabilir. Örnek: Men s Health: Sağlıklı Beslenmek İçin Doğru Yiyecekleri Doğru Zamanda Yiyin Fd gjd dkjıboısmblkd vkjdgneırgnlfdjnkdnbsd nfdjgoıgnıfgnodfsa vnldfnongpıasngoa fngadlgksamlkanb ıepamakdnvlkfnvdklnlkadfganglkanvlkanvlfdnldfbdjndfjv jf jf sjnblsfnnvj f jsnlsdoıenvldvsdmb sjb sdlısfosdf. Devamını oku (5 Kredi)

20 *Kredili içeriği paylaş, 10 da 1 pay al. Örnek gizlilik ayarı: Kredili içerikleri gösterme. -Kullanıcılar kendi kredili içeriklerini oluşturabilsin. Böylece çok paylaşılan şeyler için bir geri dönüş olur ve teşvik eder. Örnek gizlilik ayarı: Ahmet in paylaştığı kredili içerikleri gösterme. Seçenekler: 1 hafta, 1 ay, 1 yıl, 1 asır. -Kredili içeriklerin ücretsiz arşivlenebilmesi gibi bir özellik sunabilirsin. Ayrıca kredili içerikler sunmaları için dergilerle konuşabilirsin. İnsanlar takip ettikleri dergilerin kredili içeriklerini görürler ve küçük maliyetler belki de bir miniekonomi yaratır. Bunların kopyalanmasını nasıl engelleyeceğini bilmiyorum.

21 Krediler Hakkında -Kullanıcıya profilini geliştirmesi durumunda kredi ver. Diğer kullanıcıların rağbet ettiği şeyler için daha fazla kredi ver. -Site sahiplerine sitelerinden gönderecekleri insanlar için daha sonra ağda reklam yapmak için kullanabilecekleri krediler ver. PR si yüksek siteler için kredi miktarını daha yüksek oranlarla çarp. -Kredileri kullanmak için sanal seçenekler sun. Mesela profil videoları oluşturabilsin. Editörler bu videolardan küçük hareketli resimler ayıklasınlar. Kullanıcı bunlardan birisini seçip profil resmi yapsın, resme tıklanınca kullanıcının site üzerinden kaydettiği, profil videosu oynamaya başlasın. Bu küçük hareketli resimler konusunda en son Microsoft bir araç çıkarmıştı.

22 Rekabet Konusunda -Sektörel araçları kullanarak rakiplerinin arama motorları ile ziyaretçi çektiği kelimelere reklam ver. -Yeterli kredi toplayan kullanıcılar için isimleri arandığında profil adreslerinin çıkması için Google reklamları ver. Hem ucuz, hem ilgi çekici. -*Farklı türde kullanıcıları çekmekten bahsetmiştim. Sitenle alakalı olmasa da bilim insanları gibi sosyal ağlarda olmayanlar için yaptıkları spesifik aramalar için reklamlar ver. Bu terimler bilimsel terimler olacağından, hem reklam masrafları ucuz olacak, hem de ağın kullanıcı çeşitliliğini artırarak ağın cazibesini ve kalitesine katkı sağlayacak. -Sitelere koyduracağın takiple içerik paylaşımı butonları için güzel seçenekler sun. Bunun için site sahiplerine krediler ver, anlaşmalar yap.

23 DİKKAT ET -Kullanıcı verilerini çaldırma. Özellikle özel olanları. -Başarılı bir saldırıya maruz kalma. -Geri beslemelerden uzak kalma, çok yakında olma. -Gözlerini rakiplerinin ve potansiyel rakiplerinin üzerinden ayırma. -Yarının teknolojisini yarına bırakma. Çok erkende sunma. -Aynı kalma, kullanıcıyı sıkma. -Diğerlerinden geride kalma. -Odak noktanı çok fazla dağıtma, bir plana da saplanıp kalma.

24 Son Birkaç Şey -Üniversite öğrenci otomasyonlarına sistem üzerinden erişebilme. Ders programı üzerinde etkinlik oluşturabilme (böylece arkadaşlarının gittiği derslere gidebilirsin). Sınavlar üzerinde ders notu paylaşımı. *Bunu her üniversite için uygulama şeklinde ekle. Bunun için curl teknolojisini kullanabilirsin. -Profil bilgisinden burç tespiti, burç özelliklerinden reklam ayarlama ve burç özelliklerinin kullanıcıya veya arkadaşlarına sorulup bu sende var mı denilerek profile eklenmesi. Burç olduğunu söylemezsen, sürpriz olur, merak da. Fala inanma, falsız da kalma.

25 -Huzur evleri için takiplen tabletleri. Parmak izi ile kullanıcı adı ve parola girişi yapacak. Ses ile içerik girişi yapılabilecek. Arayüzü erişilebilirleştirilmiş, yaşlıların aileleri ile görüntülü konuşma, fotoğraflarına bakma, ses ile yorum yapma (yazıya dönüşürülecek) gibi özelliklerin sunulması. -Ekibi ve şirketi canlı tut. Zamanın gerisinde kalman büyük bir olasılıktır. Dikkatli ol. -Ayrıca kullanıcılarının şunu anlamasını sağla: Bedava yoktur, çapraz sübvansiyon vardır. -Ben Kendim SON OLARAK;

26

27 İşler beklediğin gibi gitmediğinde, moralini gereğinden fazla bozma.

28

Hashtag ile ilgili bilmeniz gereken herşey Ne zaman hashtag yapmalıyım, nasıl hashtag oluşturmalıyım? HASHTAG KULLANIM REHBERİ

Hashtag ile ilgili bilmeniz gereken herşey Ne zaman hashtag yapmalıyım, nasıl hashtag oluşturmalıyım? HASHTAG KULLANIM REHBERİ HASHTAG KULLANMA REHBERİ 1 Hashtag ile ilgili bilmeniz gereken herşey Ne zaman hashtag yapmalıyım, nasıl hashtag oluşturmalıyım? #HASHTAG Hangimiz günlük olarak kullandığımız sosyal medya platformlarında

Detaylı

BİLGİ PAYLAŞIM ARAÇLARI. İşbirlikli Yazarlık Çoklu Ortam Paylaşımları Web Günceleri Etiketleme ve Sosyal İmleme Sosyal Medya Dijital Kimlik

BİLGİ PAYLAŞIM ARAÇLARI. İşbirlikli Yazarlık Çoklu Ortam Paylaşımları Web Günceleri Etiketleme ve Sosyal İmleme Sosyal Medya Dijital Kimlik BİLGİ PAYLAŞIM ARAÇLARI İşbirlikli Yazarlık Çoklu Ortam Paylaşımları Web Günceleri Etiketleme ve Sosyal İmleme Sosyal Medya Dijital Kimlik İŞBİRLİKLİ YAZARLIK İçeriğinin kullanıcıların katkılarıyla oluşturulduğu

Detaylı

Oturum aç butonuna tıklayın.

Oturum aç butonuna tıklayın. Adım 1 Oturum açın. Oturum aç butonuna tıklayın. Adım 1 Oturum açın. Kullanıcı adınızı ve şifrenizi yazın. İpucu: Eğer şifrenizi hatırlayamazsanız, Şifrenizi mi unuttunuz? istemini kullanın. Adım 2 Profilinizi

Detaylı

WEB ARAÇLARI VE UZAKTAN EĞİTİM CEIT357-4.HAFTA

WEB ARAÇLARI VE UZAKTAN EĞİTİM CEIT357-4.HAFTA WEB ARAÇLARI VE UZAKTAN EĞİTİM CEIT357-4.HAFTA 1 Giriş Bu bölümümde günümüzde en çok kullanılan Web araçları tanıtılacak ve anlatılacaktır.bunların eğitimde, özellikle uzaktan eğitimde nasıl kullanıldığından

Detaylı

Ortak Dersler Sanal Sınıf Sistemi Kullanım Kılavuzu

Ortak Dersler Sanal Sınıf Sistemi Kullanım Kılavuzu Ortak Dersler Sanal Sınıf Sistemi Kullanım Kılavuzu Ortak Dersler, tüm üniversite bölümlerinde fakülte ve meslek yüksekokulu farkı gözetmeksizin, aynı olan bazı derslerin tek bir sistem üzerinden öğretimin

Detaylı

Yrd. Doç. Dr. Gökçe BECİT İŞÇİTÜRK. Gökçe BECİT İŞÇİTÜRK 1

Yrd. Doç. Dr. Gökçe BECİT İŞÇİTÜRK. Gökçe BECİT İŞÇİTÜRK 1 Yrd. Doç. Dr. Gökçe BECİT İŞÇİTÜRK Gökçe BECİT İŞÇİTÜRK 1 Gökçe BECİT İŞÇİTÜRK 2 Kullanıcıların site içeriğini belirlemede rol oynadığı, Dinamik, Teknik bilgi gerektirmeyen, Çok yönlü etkileşim sağlayan,

Detaylı

Blog Nedir? Blog un Tarihçesi Türkiye de Blog Eğitimde Blog Neden Blog Blog Türleri

Blog Nedir? Blog un Tarihçesi Türkiye de Blog Eğitimde Blog Neden Blog Blog Türleri BLOG BLOG 1 2 3 4 5 6 Blog Nedir? Blog un Tarihçesi Türkiye de Blog Eğitimde Blog Neden Blog Blog Türleri Blog Nedir? Blog, teknik bilgi gerektirmeden, kendi istedikleri şeyleri, kendi istedikleri şekilde

Detaylı

«Pek çok küçük şey, doğru reklamla devleşmiştir.» Mark Twain

«Pek çok küçük şey, doğru reklamla devleşmiştir.» Mark Twain Video Reklamlar «Pek çok küçük şey, doğru reklamla devleşmiştir.» Mark Twain 1 2 3 4 Türkiye deki Arama Türkiye Pazarında Arama Hacmi Türkiye de Beyazperde Nerede? Rakip Analizi, Yıllık Analiz YouTube

Detaylı

Sosyal paylaşım sitesi Facebook üzerinde 22.500 genç takipçisi ve aylık ortalama 40.000 yeni ziyaretçisi ile yayınına devam etmektedir.

Sosyal paylaşım sitesi Facebook üzerinde 22.500 genç takipçisi ve aylık ortalama 40.000 yeni ziyaretçisi ile yayınına devam etmektedir. GENEL BĐLGĐLERĐMĐZ 2008 den 2011 e kadar sosyal paylaşım siteleri üzerinden takipçilerine hizmet veren Etkin Ankara, 2011 Ekim ayında etkinankara.com sitesi üzerinden faaliyete geçmiş ve Ekim 2011 Ağustos

Detaylı

Dijital pazarlama bir satış yöntemi değil; ulaşılan sonuçları sayesinde satış artışı sağlayan, bir ilişkilendirme ve iletişim sürecidir.

Dijital pazarlama bir satış yöntemi değil; ulaşılan sonuçları sayesinde satış artışı sağlayan, bir ilişkilendirme ve iletişim sürecidir. Dijital pazarlama bir satış yöntemi değil; ulaşılan sonuçları sayesinde satış artışı sağlayan, bir ilişkilendirme ve iletişim sürecidir. Dijital Pazarlama, rekabet avantajı için yeni kaynaklara ulaşımı

Detaylı

Sanaltercih, üniversite adaylarının üniversite ve bölüm tercihlerinde dogru kararlar vermesini sağlayan tercih simülatörü dür.

Sanaltercih, üniversite adaylarının üniversite ve bölüm tercihlerinde dogru kararlar vermesini sağlayan tercih simülatörü dür. www.sanaltercih.com Sanaltercih nedir? Sanaltercih, üniversite adaylarının üniversite ve bölüm tercihlerinde dogru kararlar vermesini sağlayan tercih simülatörü dür. Vizyonu nedir? Türkiye de üniversite

Detaylı

MediaClick Web Tasarım Hakkında

MediaClick Web Tasarım Hakkında MediaClick Web Tasarım Hakkında MediaClick, Gen Medya A.Ş. bünyesinde yer alan, Bütünleşik Dijital İletişim Ajansı dır. Biz bu kelimeyi özellikle kullanıyoruz. Zira, bir web projesinin başarısının sadece

Detaylı

Hootsuite Tanıtım Sunumu. Hoşgeldiniz

Hootsuite Tanıtım Sunumu. Hoşgeldiniz Hootsuite Tanıtım Sunumu Hoşgeldiniz Hootsuite Nedir? Hootsuite, dünyanın en çok kullanılan sosyal medya yönetim platformudur Hootsuite ile tüm sosyal medya hesaplarınızı tek bir merkezden kolayca yönetebilirsiniz

Detaylı

SEO ve Sosyal Medya Tanıtım Semineri SEMİNER SÜRESİ 2 SAAT BİLGİYAZAN YAZILIM EĞİTİM VE DANIŞMANLIK HİZMETLERİ

SEO ve Sosyal Medya Tanıtım Semineri SEMİNER SÜRESİ 2 SAAT BİLGİYAZAN YAZILIM EĞİTİM VE DANIŞMANLIK HİZMETLERİ SEO ve Sosyal Medya Tanıtım Semineri SEMİNER SÜRESİ 2 SAAT BİLGİYAZAN YAZILIM EĞİTİM VE DANIŞMANLIK HİZMETLERİ Eğitim Ücreti: Ücretsiz Eğitim Programının Amacı: SEO Sosyal Medya Dijital Pazarlama Sanatı

Detaylı

SİZİN WEB SİTENİZ BİR TANEDİR!

SİZİN WEB SİTENİZ BİR TANEDİR! 1 SİZİN WEB SİTENİZ BİR TANEDİR! Tabi şu da bir gerçek ki, sizin siteniz 350 milyon ve hala artmakta olan siteden bir tanesidir. Sitenizin diğerlerinden ayrılması ve ayakta kalması için ne yapabilirsiniz?

Detaylı

GOOGLE DRİVE KULLANARAK FORM OLUŞTURMA

GOOGLE DRİVE KULLANARAK FORM OLUŞTURMA GOOGLE DRİVE KULLANARAK FORM OLUŞTURMA Google Docs yani Google Dokümanlar hizmeti bir süre önce Google Drive adlı bulut depolama hizmetinin içerisine alındı ve çok daha gelişerek yoluna devam etti. Google

Detaylı

2.3. Bilgi Paylaşımı için Araçlar

2.3. Bilgi Paylaşımı için Araçlar 2.3. Bilgi Paylaşımı için Araçlar 2.3.1. İşbirlikli Yazarlık (Ör: Viki) 2.3.2. Çoklu Ortam Paylaşımları (Ör: YouTube, Flickr) 2.3.3. Web Günceleri (Ör: Bloglar) 2.3.4. Etiketleme ve Sosyal İmleme (Ör:

Detaylı

LOGİN EKRANI. Şekil -1

LOGİN EKRANI. Şekil -1 LOGİN EKRANI Yönetim paneline ilk giriş ekranıdır, size verilen kullanıcı adı ve parola girilerek yönetim paneline giriş yapılır. Şifresiz girilemez, şifrenizi unuttunuz yada kaybettiniz ise lütfen PRO.GEN

Detaylı

EĞİTMENLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ KULLANMA KILAVUZU

EĞİTMENLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ KULLANMA KILAVUZU EĞİTMENLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ KULLANMA KILAVUZU ÖĞRENME YÖNETİM SİSTEMİ MOODLE Öğrenme Yönetim Sistemleri, ağ üzerinden eş zamanlı olmayan öğrenme materyali sunma, sunulan öğrenme materyalini

Detaylı

SOSYAL MEDYADA EĞİTİM UYGULAMALARI. Yasin YÜKSEL

SOSYAL MEDYADA EĞİTİM UYGULAMALARI. Yasin YÜKSEL SOSYAL MEDYADA EĞİTİM UYGULAMALARI Yasin YÜKSEL Araştırma konusu: Sosyal medyanın -özellikle yüksek öğretimde olmak üzere- eğitime katkısını, bu konuda yapılan araştırmaları, istatistikleri ve uygulamaları

Detaylı

ÖĞRENCİLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ KULLANMA KILAVUZU

ÖĞRENCİLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ KULLANMA KILAVUZU ÖĞRENCİLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ KULLANMA KILAVUZU ÖĞRENME YÖNETİM SİSTEMİ MOODLE Öğrenme Yönetim Sistemleri, Ağ üzerinden eş zamanlı olmayan öğrenme materyali sunma, sunulan öğrenme materyalini

Detaylı

AKOFİS.NET - PRATİK BİLGİLER. Bu sunum; siz değerli müşterilerimizin web sitemizi kolay kullanmanız için pratik bilgiler vermeyi amaçlamaktadır.

AKOFİS.NET - PRATİK BİLGİLER. Bu sunum; siz değerli müşterilerimizin web sitemizi kolay kullanmanız için pratik bilgiler vermeyi amaçlamaktadır. AKOFİS.NET - PRATİK BİLGİLER Bu sunum; siz değerli müşterilerimizin web sitemizi kolay kullanmanız için pratik bilgiler vermeyi amaçlamaktadır. Siteye Giriş Siteye üye girişi yapmak için ana sayfada, sağ

Detaylı

YAKIN DOĞU ÜNİVERSİTESİ. Uzaktan Eğitim Merkezi NEU-UZEM ÖĞRENCİLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ(MOODLE) KULLANMA KLAVUZU

YAKIN DOĞU ÜNİVERSİTESİ. Uzaktan Eğitim Merkezi NEU-UZEM ÖĞRENCİLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ(MOODLE) KULLANMA KLAVUZU YAKIN DOĞU ÜNİVERSİTESİ Uzaktan Eğitim Merkezi NEU-UZEM ÖĞRENCİLER İÇİN ÖĞRENME YÖNETİM SİSTEMİ(MOODLE) KULLANMA KLAVUZU ÖĞRENME YÖNETİM SİSTEMİ MOODLE Öğrenme Yönetim Sistemleri, Ağ üzerinden eş zamanlı

Detaylı

Şimdi, resimler üzerinde anlatılanları sırasıyla ve hatasız olarak yapın.

Şimdi, resimler üzerinde anlatılanları sırasıyla ve hatasız olarak yapın. Facebook Tanıtım Uygulaması Seminer Video Sayfasına Sponsor Link Oluşturma Merhaba Değerli ProjeX Üyeleri, Aşağıdaki linke tıklayarak, Facebook Uygulaması için kendi sponsor linkinizi oluşturabilir, Facebook

Detaylı

TABLET MENÜ RESTORANLAR/KAFELER İÇİN TABLET MENÜLER

TABLET MENÜ RESTORANLAR/KAFELER İÇİN TABLET MENÜLER TABLET MENÜ RESTORANLAR/KAFELER İÇİN TABLET MENÜLER TABLET MENÜ NEDİR? Tablet bilgisayar üzerinde çalışan dokunmatik ve etkileşimli bir menüdür. Müşterilerinize sunduğunuz klasik karton menülerin yerini

Detaylı

ADOBE CONNECT 9.2.1 Versiyonu KULLANIM KLAVUZU

ADOBE CONNECT 9.2.1 Versiyonu KULLANIM KLAVUZU ADOBE CONNECT 9.2.1 Versiyonu KULLANIM KLAVUZU Menü çubuğunda toplantı sahibi Toplantı, Düzenler, Bölmeler, Ses ve Yardım menülerini görür. Sunucu veya katılımcı sadece Toplantı ve Yardım menülerini görür.

Detaylı

Hootsuite. Hızlı Başlangıç. Rehberi. Samsun Ekim 2015 ISBN: 978-605-65962-3-0

Hootsuite. Hızlı Başlangıç. Rehberi. Samsun Ekim 2015 ISBN: 978-605-65962-3-0 Hootsuite Hızlı Başlangıç Rehberi Samsun Ekim 2015 ISBN: 978-605-65962-3-0 Copyright Zeynel Abidin Çift - Samsun, Ekim 2015 Bu kitabın tüm hakları Zeynel Abidin Çift'e aittir. Kaynak gösterilmeksizin kısmen

Detaylı

ETKĐN ANKARA Ankara Artık daha Etkin

ETKĐN ANKARA Ankara Artık daha Etkin ETKĐN ANKARA Ankara Artık daha Etkin GENEL BĐLGĐLERĐMĐZ 2008 den 2011 e kadar sosyal paylaşım siteleri üzerinden takipçilerine hizmet veren Etkin Ankara, 2011 Ekim ayında etkinankara.com sitesi üzerinden

Detaylı

Turgut Özal Üniversitesi WEB Sitesi Kullanım Kılavuzu

Turgut Özal Üniversitesi WEB Sitesi Kullanım Kılavuzu Turgut Özal Üniversitesi WEB Sitesi Kullanım Kılavuzu Temmuz 2012 Turgut Özal Üniversitesi web sitesi yönetim paneline aşağıdaki link yardımıyla ulaşabiliriz. http://www.turgutozal.edu.tr/webmin/ Karşımıza

Detaylı

Google'da arayan potansiyel müşteriler sizi bulsun. edildiğinde veya telefonla arandığınızda ödeme yapın. MURATOLMEZ.COM

Google'da arayan potansiyel müşteriler sizi bulsun. edildiğinde veya telefonla arandığınızda ödeme yapın. MURATOLMEZ.COM Google Arama Ağı Reklamı. Tam olarak sunduğunuz ürün veya hizmetleri Google'da arayan potansiyel müşteriler sizi bulsun. Siz de yalnızca reklamınıztıklanıp web siteniz ziyaret edildiğinde veya telefonla

Detaylı

http://www.microsoft.com/visualstudio/eng/downloads

http://www.microsoft.com/visualstudio/eng/downloads Visual Studio 2012'nin kurulumunu, Visual Studio'nun kullanımını ve Windows Store'da basit bir proje hazırlanmasını anlatacağım. Hepsinden önce Visual Studio ortamından biraz bahsedelim. Visual Studio

Detaylı

Biz Kimiz? www.atluniversal.com

Biz Kimiz? www.atluniversal.com Web Tasarım İçin... Biz Kimiz? ATL Universal, çeşitli sektörler için internet yazılımları geliştirerek profesyonel web siteleri yapan bir web tasarım rmasıdır. Bizi ayıran farklılığımız geliştirdiğimiz

Detaylı

www.sosyalmedyaodulleri.com.tr

www.sosyalmedyaodulleri.com.tr 2015 Sosyal Medya Kulübü SMÖ 2015 Takvim Dijital Dünya da Biz Benzer Etkinlikler Sponsorluk Türleri Ana Sponsorluk Platin Sponsorluk Gold Sponsor Silver Sponsorluk Kategori Sponsorlukları Diğer Sponsorluklar

Detaylı

Facebook Sayfaları ile Facebook'taki yerinizi alın

Facebook Sayfaları ile Facebook'taki yerinizi alın Sayfaları 1 Sayfaları ile 'taki yerinizi alın Sayfanız Her gün tüm dünyada milyonlarca kişi arkadaşlarıyla iletişim kurmak ve sevdikleri şeyleri paylaşmak için 'u ziyaret ediyor. Bu kılavuz, kuruluşların

Detaylı

GLOBAL GİRİŞİMCİLİK HAFTASI 2012 PAYDAŞ MARKA REHBERİ

GLOBAL GİRİŞİMCİLİK HAFTASI 2012 PAYDAŞ MARKA REHBERİ GLOBAL GİRİŞİMCİLİK HAFTASI 2012 PAYDAŞ MARKA REHBERİ İÇİNDEKİLER Global Girişimcilik Haftası GGH nedir? Bir farkındalık kampanyasından daha fazlası Pusula yı Destekleyin Neden Pusula yı destekliyoruz?

Detaylı

17 Haziran 2014 DenizBank Güncel Haber Bülteni

17 Haziran 2014 DenizBank Güncel Haber Bülteni 17 Haziran 2014 DenizBank Güncel Haber Bülteni Mobil RTB Harcamaları %459 Artış Gösterdi emarketer tahminlerine göre RTB harcamaları (tüm reklam çeşitleri dahil) 2018 yılında toplamda $12 milyar a ulaşacak.

Detaylı

İnteraktif Türkler 2009 İnteraktif Mecra Kullanım Araştırması

İnteraktif Türkler 2009 İnteraktif Mecra Kullanım Araştırması İnteraktif Türkler 2009 İnteraktif Mecra Kullanım Araştırması Türkiye nin ilk ve öncü dijital ajansı adinteractive in Türk internet kullanıcısının davranış alışkanlıklarına ışık tuttuğu araştırması İnteraktif

Detaylı

[E-Katalog Tanıtım Sayfası] Ayser Bilgisayar. Cumhuriyet Meydanı No:41 Kat:2 0286 217 60 34

[E-Katalog Tanıtım Sayfası] Ayser Bilgisayar. Cumhuriyet Meydanı No:41 Kat:2 0286 217 60 34 [E-Katalog Tanıtım Sayfası] Ayser Bilgisayar Cumhuriyet Meydanı No:41 Kat:2 0286 217 60 34 Neden Ayser Bilgisayar? Bundan 10 yıl önce insanlar bir ürün almak için mağaza mağaza dolaşırlar ve farklı fiyatları

Detaylı

TTEC Standalone DVR Kolay Kurulum Dokümanı. Kurulum Adımları

TTEC Standalone DVR Kolay Kurulum Dokümanı. Kurulum Adımları TTEC Standalone DVR Kolay Kurulum Dokümanı Bu dokümanda TTEC Standalone DVR cihazının kurulum adımları ile ilgili açıklamaları bulabilirsiniz. Öncelikle cihaz ile ilgili bilinmesi gereken varsayılan bilgiler

Detaylı

NU SKIN SOSYAL BİR TİCARETTİR NU SKIN SOCIAL MEDIA GUIDELINES

NU SKIN SOSYAL BİR TİCARETTİR NU SKIN SOCIAL MEDIA GUIDELINES NU SKIN SOSYAL BİR TİCARETTİR NU SKIN SOCIAL MEDIA GUIDELINES 1 DOĞRUDAN SATIŞ; ORJİNAL SOSYAL AĞ OLARAK DEĞERLENDİRİLEBİLİR İş modelimiz yüz yüze satış temeline dayanmaktadır sözlü olarak, ağızdan ağıza

Detaylı

PROJELERİN GÖRÜNÜRLÜĞÜNÜ ARTIRMA KONUSUNDA İPUÇLARI

PROJELERİN GÖRÜNÜRLÜĞÜNÜ ARTIRMA KONUSUNDA İPUÇLARI PROJELERİN GÖRÜNÜRLÜĞÜNÜ ARTIRMA KONUSUNDA İPUÇLARI Görünürlük ve Yaygınlaştırma 1-Proje Esnasında Faaliyetlerin Duyurulması 2-Proje Sonuçlarının Duyurulması Proje Faaliyetlerinizden Önce Yapılması Gerekenler:

Detaylı

ADAMA Gizlilik Yönergesi

ADAMA Gizlilik Yönergesi ADAMA Gizlilik Yönergesi İşbu Gizlilik Yönergesi ( Gizlilik Yönergesi ) 1 Nisan 2014 tarihinde yürürlüğe girecektir. İşbu Gizlilik Yönergesi zaman zaman güncellenecektir. Gizlilik Yönergemizi aralıklarla

Detaylı

Tablet aktivasyonu yardım sayfası

Tablet aktivasyonu yardım sayfası Tablet aktivasyonu yardım sayfası Sırasıyla aşağıdaki işlemleri yapmanız gerekmektedir Her okuldaki sınıf öğretmeni kendisi ve öğrencileri için EBA şifresi oluşturmalıdır. Daha önce EBA şifresi oluşturduysanız

Detaylı

İçindekiler ADIM 1 : Üye Olma... 2 ADIM 2 : Giriş Yap ve Hatırlatma Sayfaları... 3 ADIM 3: Üye Girişi yapıldıktan sonra yapabileceğiniz işlemler...

İçindekiler ADIM 1 : Üye Olma... 2 ADIM 2 : Giriş Yap ve Hatırlatma Sayfaları... 3 ADIM 3: Üye Girişi yapıldıktan sonra yapabileceğiniz işlemler... İçindekiler ADIM 1 : Üye Olma... 2 ADIM 2 : Giriş Yap ve Hatırlatma Sayfaları... 3 ADIM 3: Üye Girişi yapıldıktan sonra yapabileceğiniz işlemler... 3 ADIM 4: Bildiri Özet Gönderimi Bilgilendirme ve Yardım

Detaylı

FATURA Fatura kayıtları sekmesinden Alış Faturası- Satış Faturası- Alış İade Faturası- Satış İade Faturası ve Hızlı Satış Faturasını girebilirsiniz.

FATURA Fatura kayıtları sekmesinden Alış Faturası- Satış Faturası- Alış İade Faturası- Satış İade Faturası ve Hızlı Satış Faturasını girebilirsiniz. FATURA Fatura kayıtları sekmesinden Alış Faturası- Satış Faturası- Alış İade Faturası- Satış İade Faturası ve Hızlı Satış Faturasını girebilirsiniz. Şimdi Fatura nın içindeki sekmeleri ve sekmelerin içindeki

Detaylı

KARAYOLU TRAFİK GÜVENLİĞİ IOS ve ANDROİD TABANLI UYGULAMA, OYUN VE İNTERAKTİF KİTAP YARIŞMASI

KARAYOLU TRAFİK GÜVENLİĞİ IOS ve ANDROİD TABANLI UYGULAMA, OYUN VE İNTERAKTİF KİTAP YARIŞMASI KARAYOLU TRAFİK GÜVENLİĞİ IOS ve ANDROİD TABANLI UYGULAMA, OYUN VE İNTERAKTİF KİTAP YARIŞMASI 1. KONU: Hazırlanacak çalışmalar, trafik güvenliği ile ilgili doğru bilgi ve tutumları konu edecektir. 2. AMAÇ:

Detaylı

UZAKTAN EĞİTİM SİSTEMİ ÖĞRENCİ EKRANLARI KULLANIM KILAVUZU

UZAKTAN EĞİTİM SİSTEMİ ÖĞRENCİ EKRANLARI KULLANIM KILAVUZU UZAKTAN EĞİTİM SİSTEMİ ÖĞRENCİ EKRANLARI KULLANIM KILAVUZU 1 GİRİŞ Bu doküman içerisinde, hizmete sunulan Uzaktan Eğitim Sistemi (UZEM) öğrenci ekranlarının kullanımına yönelik yardım içeriği bulunmaktadır.

Detaylı

WordPress ile Web Sayfası Tasarımı

WordPress ile Web Sayfası Tasarımı WordPress ile Web Sayfası Tasarımı WordPress nedir? WordPress, dünyada en çok kullanılan blog sistemlerinden biridir, açık kaynaklı ve ücretsiz olarak dağıtılmaktadır.wordpress açık kaynaklı bir yazılım

Detaylı

Google Adwords Reklam Stratejileri ve Markalar İçin Önemi

Google Adwords Reklam Stratejileri ve Markalar İçin Önemi Google Adwords Reklam Stratejileri ve Markalar İçin Önemi Türkiye de İnternet Kullanımı Potansiyel Müşterileriniz Artık Size İnternet Üzerinden Ulaşıyor Amacınız işletmenizin daha fazla ulaşılır olmasını

Detaylı

Responsive Tasarım Önerileri!

Responsive Tasarım Önerileri! Responsive Tasarım Önerileri! !Mobil kullanıcı, masaüstü kullanıcısından farklı olarak hedef odaklı hareket eder. Gezinti ve keşif deneyimini geliştirmek için gereksiz objeleri ve hataları minimalize etmelisiniz.!

Detaylı

ADOBE CONNECT SANAL SINIF ÖĞRENCİ KULLANIM KILAVUZU

ADOBE CONNECT SANAL SINIF ÖĞRENCİ KULLANIM KILAVUZU ADOBE CONNECT SANAL SINIF ÖĞRENCİ KULLANIM KILAVUZU SOSYAL BİLİMLER ENSTİTÜSÜ UZAKTAN EĞİTİM MERKEZİ 2014 Sayfa 1 Sisteminde sanal dersler Adobe Connect üzerinden yürütülmektedir. ADOBE CONNECT Adobe Connect,

Detaylı

Eğitimde Bilişim Teknolojilerinin Yeri Ve Önemi

Eğitimde Bilişim Teknolojilerinin Yeri Ve Önemi Eğitimde Bilişim Teknolojilerinin Yeri Ve Önemi Sunumumuza Bir Soru İle Başlayalım Laptop Tablet Masaüstü Pc Akıllı Telefon Soru1: Hangisini Kullanıyorsunuz? Laptop Tablet Masaüstü Pc Akıllı Telefon Soru2:

Detaylı

BİLGİLENDİRİCİ REHBER. Mobil Uygulama İncelemesi

BİLGİLENDİRİCİ REHBER. Mobil Uygulama İncelemesi BİLGİLENDİRİCİ REHBER Mobil Uygulama İncelemesi ANA ÖZELLİKLER Konuşma Başlatıcı Nu Skin fırsat odaklı Yerleşik Kilo uygulaması Paylaşım fonksiyonları Müşteri Yönetimi Kusursuz bilgi toplama Otomatik arama

Detaylı

Microsoft Outlook 2007

Microsoft Outlook 2007 Microsoft Outlook 2007 Outlook ürünü belge, elektronik tablo, sunu oluşturma ve e-posta yönetme için farklı türden yazılımların birleştirildiği "Office" ürün paketinin bir parçasıdır. Outlook, özellikle

Detaylı

ADOBE CONNECT ÖĞRENCİ VERSİYONU SANAL SINIF KULLANIM KILAVUZU

ADOBE CONNECT ÖĞRENCİ VERSİYONU SANAL SINIF KULLANIM KILAVUZU ADOBE CONNECT ÖĞRENCİ VERSİYONU SANAL SINIF KULLANIM KILAVUZU UZAKTAN EĞİTİM MERKEZİ BİLGİ İŞLEM DAİRE BAŞKANLIĞI 2014 Işık Üniversitesi Uzaktan Eğitim Merkezi Sayfa 1 Işık Üniversitesi Uzaktan Eğitim

Detaylı

Öğrenme Örnekleri Hazırlama

Öğrenme Örnekleri Hazırlama Modül 4 Öğrenme Örnekleri Hazırlama Bu Defter Intel Öğretmen Programı Çevrimiçi kapsamında kullanılacaktır. Tüm kurs boyunca, düşüncelerinizi çevrimiçi araçlara veya bu deftere kayıt edebilirsiniz. Bu

Detaylı

Ben. https://www.linkedin.com/in/halilsoyler

Ben. https://www.linkedin.com/in/halilsoyler Facebook Reklamları Ben https://www.linkedin.com/in/halilsoyler Markalar Facebook Bitti Mi? Hayır. Facebook kullanıcılarının %92 si birbirlerine «4 degrees of seperation» ile bağlı. 1.320.000.000 aylık

Detaylı

Your Digital Agency in Europe. Web Tasarım & Dijital Medya Çözümleri

Your Digital Agency in Europe. Web Tasarım & Dijital Medya Çözümleri Paragon Web Tasarım & Dijital Medya Çözümleri Hakkımızda DENEYİM Rakipsiz YARATICILIK Takip edilen YENİLİKLER Biz Kimiz? ParagonTasarım dijital medya alanında hizmet veren İstanbul merkezli bir tasarım

Detaylı

TrueView ile Video için Google AdWords.

TrueView ile Video için Google AdWords. TrueView ile Video için Google AdWords. Reklam videonuzu izleyen kişilerş için ödeme yapın. YouTube'un Boyutu ve Kapsamı. #1 Çevrimiçi video sitesi #2 En büyük arama motoru (Google'dan sonra) #3 En büyük

Detaylı

-SOSYAL MEDYA ARAŞTIRMASI-

-SOSYAL MEDYA ARAŞTIRMASI- -SOSYAL MEDYA ARAŞTIRMASI- Pazarlamadünyasi.com un Vodaco Agency işbirliği ile 04 Ağustos 30 Eylül 2009 tarihleri arasında gerçekleştirdiği Sosyal Medya araştırması sonuçlandı. İnternet kullanıcıları sosyal

Detaylı

Ana Menü. Ana Menü (Main Page) İçerisindekiler;

Ana Menü. Ana Menü (Main Page) İçerisindekiler; Ana Menü Ana Menü (Main Page) İçerisindekiler; 1- Genel 2 - Disk Yönetimi 1-1) Sistem Zamanı 3 - Kayıt Oynatma 1-2) Zaman Senkronizasyon 4 - Kayıt Modu 1-3) Tarih Formatı 4-1) Sürekli Kayıt 1-4) Dil 4-2)

Detaylı

EĞİTMEN KULLANIM KILAVUZU

EĞİTMEN KULLANIM KILAVUZU EĞİTMEN KULLANIM KILAVUZU ALMS kullanıcılarının talepleri yönünde geliştirilecek ve istedikleri şekilde değişiklikler yapabilecekleri dinamik bir yapıda tasarlandı. Bu değişiklikleri yapma yetkisi sistem

Detaylı

10 Haziran 2014 DenizBank Güncel Haber Bülteni

10 Haziran 2014 DenizBank Güncel Haber Bülteni 10 Haziran 2014 DenizBank Güncel Haber Bülteni Apple dan Bitcoin Açılımı Apple, App Store kılavuzunda yenilemeye giderek sanal para birimlerini kabul edebileceğini belirtti. TechCrunch un farkettiği yenilikte

Detaylı

Ondokuz Mayıs Üniversitesi Sürüm 1.0 Aralık 2015

Ondokuz Mayıs Üniversitesi Sürüm 1.0 Aralık 2015 y Ondokuz Mayıs Üniversitesi Sürüm 1.0 Aralık 2015 Bulut Depolama, genel bir terimle "dosya barındırma" hizmeti sunan bir yazılım sistemidir. Bu hizmet sayesinde önemli dosyalarınızı yedekleyebilir veya

Detaylı

Tanıtım Toplantısı. 24 Ekim 2014

Tanıtım Toplantısı. 24 Ekim 2014 Tanıtım Toplantısı 24 Ekim 2014 Projenin Amacı Nisan da Adana da olmak. Marka Şehir : Adana Yemekleri, yetiştirdiği ünlüleri, tarihi, geleneksel ve kültürel değerleriyle tanınan Adana nın Nisan ayında

Detaylı

Anaokulu Bilgi ve İletişim Sistemi

Anaokulu Bilgi ve İletişim Sistemi Anaokulu Bilgi ve İletişim Sistemi Kullanıcı Kılavuzu [Sürüm 1.0-23.12.2015] 1 İçindekiler Kurulum İşlemleri / İlk Kullanım...3 Hızlı başlangıç...4 Etkinlik planlama...5 Yemek Planlama...5 Servis Planlama...5

Detaylı

EBA Dosya Uygulaması Kullanıcı K ı lavuzu ( Mobil)

EBA Dosya Uygulaması Kullanıcı K ı lavuzu ( Mobil) EBA Dosya Uygulaması Kullanıcı K ı lavuzu ( Mobil) İçindekiler EBA Dosya nedir?... 3 Kimler kullanabilir?... 3 Uygulama Ne işe Yarar?... 4 Mobil uygulama nedir? Nereden ulaşabilirim?... 4 Mobil Uygulamayı

Detaylı

Güvenli Doküman Senkronizasyonu

Güvenli Doküman Senkronizasyonu Güvenli Doküman Senkronizasyonu Güvenli Doküman Senkronizasyon sistemi, hızlı ve güvenli kurumsal doküman paylaşım ve senkronizasyon uygulamasıdır. GDS ne sağlar?» Kurumsal hafıza oluşturulmasını sağlar,»

Detaylı

UZAKTAN EĞİTİM MERKEZİ

UZAKTAN EĞİTİM MERKEZİ NAMIK KEMAL ÜNİVERSİTESİ UZAKTAN EĞİTİM MERKEZİ ÖĞRETİM YÖNETİM SİSTEMİ (LMS-LEARNING MANAGEMENT SYSTEM) KULLANIM KILAVUZU 2013 İÇERİK Uzaktan Eğitim Merkezi Hakkında Genel Bilgi...3 Uzaktan Eğitim Merkezi

Detaylı

Cihazınızın İnternet ayarlarını yapabilmek için lütfen aşağıdaki adımları takip ediniz;

Cihazınızın İnternet ayarlarını yapabilmek için lütfen aşağıdaki adımları takip ediniz; Kurulum WEB UI Değerli Müşterimiz, Cihazınızın İnternet ayarlarını yapabilmek için lütfen aşağıdaki adımları takip ediniz; Öncelikle modem ve bilgisayarınız arasına lütfen bir Ethernet (LAN) kablosu takınız.

Detaylı

Oluşturmak istediğimiz OU ye bir isim veriyoruz. Name kısmına ISTANBUL yazıyoruz,

Oluşturmak istediğimiz OU ye bir isim veriyoruz. Name kısmına ISTANBUL yazıyoruz, ORGANİZATİONAL UNİT (OU) OrganizationUnit(OU): Türkçe Yapısal Birim olarak adlandırılan ve merkezi yönetimimizi kolaylaştıran bir objedir. Organizational Unit domain içerisindeki kullanıcı, group ve bilgisayarları

Detaylı

Hoş Geldiniz! Yandex.Disk aracılığıyla neler yapabileceğiniz konusunda açıklamaları bu dosyada bulabilirsiniz:

Hoş Geldiniz! Yandex.Disk aracılığıyla neler yapabileceğiniz konusunda açıklamaları bu dosyada bulabilirsiniz: Hoş Geldiniz Yandex.Disk ile dosyalar hep yanınızda. Dünyanın her yerinde, internet bağlantısı olan tüm cihazlardan fotoğraf, video ve dökümanlarınıza erişebilirsiniz. Yandex.Disk aracılığıyla neler yapabileceğiniz

Detaylı

DOKUZ EYLÜL ÜNİVERSİTESİ TIP FAKÜLTESİ e-pdö UYGULAMA YÖNERGESİ. www.e-pdo.com

DOKUZ EYLÜL ÜNİVERSİTESİ TIP FAKÜLTESİ e-pdö UYGULAMA YÖNERGESİ. www.e-pdo.com DOKUZ EYLÜL ÜNİVERSİTESİ TIP FAKÜLTESİ e-pdö UYGULAMA YÖNERGESİ www.e-pdo.com Uygulama adresi: e-pdö web uygulamasını kullanabilmek için; En güncel Google Chrome web tarayıcısı, Mikrofon (Bas Konuş sisteminde

Detaylı

İ.Ü. AÇIK VE UZAKTAN EĞİTİM FAKÜLTESİ Tanıtım Faaliyetleri Standartları Standardı

İ.Ü. AÇIK VE UZAKTAN EĞİTİM FAKÜLTESİ Tanıtım Faaliyetleri Standartları Standardı Dök. No: AUZEF-SS-2.1-10 Yayın Tarihi:30.06.2014 Rev.No:00 Rev Tarihi: Sayfa 1 / 8 1. AMAÇ... 3 2. KAPSAM... 3 3. SORUMLULAR... 3 4. TANIMLAR... 3 5. AUZEF Tanıtım Faaliyetlerin Standartları... 3 5.1.

Detaylı

İletişim. http://uzem.kemerburgaz.edu.tr. uzem@kemerburgaz.edu.tr

İletişim. http://uzem.kemerburgaz.edu.tr. uzem@kemerburgaz.edu.tr İletişim http://uzem.kemerburgaz.edu.tr uzem@kemerburgaz.edu.tr 1 İçindekiler 1. Ders ve Kullanıcı Bilgileri Hakkında... 3 1.1. Derslere Giriş Saatleri... 5 2. Kişisel Bilgisayarlar Üzerinden Sanal Sınıflara

Detaylı

IRMAK HANDAN iarslanoglu@boomads.com. : @irmakhandan

IRMAK HANDAN iarslanoglu@boomads.com. : @irmakhandan IRMAK HANDAN iarslanoglu@boomads.com : @irmakhandan What s yours? Bulunduğumuz çağın ekosisteminin özünde «paylaşmak» ve «konuşmak» yer alıyor. TÜKETİCİ HİKAYELERİ HİKAYELERİN GÜCÜ NEREDEN GELİYOR? EĞLENCELİ

Detaylı

1. Bilgisayarınızda kullandığınız Web tarayıcı programını (Internet Explorer, Mozilla Firefox vb.) çalıştırınız.

1. Bilgisayarınızda kullandığınız Web tarayıcı programını (Internet Explorer, Mozilla Firefox vb.) çalıştırınız. Kurulum WEB UI Değerli Müşterimiz, Cihazınızın İnternet ayarlarını yapabilmek için lütfen aşağıdaki adımları takip ediniz. Öncelikle modem ve bilgisayarınız arasına lütfen bir Eternet (LAN) kablosu takınız.

Detaylı

ÇOMÜ Kütüphaneleri. Kütüphane ve Elektronik Yayınların Kullanımı

ÇOMÜ Kütüphaneleri. Kütüphane ve Elektronik Yayınların Kullanımı ÇOMÜ Kütüphaneleri Kütüphane ve Elektronik Yayınların Kullanımı Büşra BİLİR busrabircan@comu.edu.tr Zühal ÇİFTCİBAŞI zuhalkasap@comu.edu.tr ÇOMÜ Kütüphaneleri 7/24 hizmet Gece ücretsiz ulaşım imkanı Ana

Detaylı

Kütüphane Web Sitesi Nedir? Bina x Web sitesi

Kütüphane Web Sitesi Nedir? Bina x Web sitesi Kütüphane Web Sitelerinde İçerik Zenginleştirme Adnan Menderes Üniversitesi Aydın 26 Ekim 2001 Dr. Hatice Kübra Bahşişoğlu kubra@hacettepe.edu.tr 04.06.2008 ÜNAK 1 Kütüphane Web Sitesi Nedir? Bina x Web

Detaylı

TSOFT FACEBOOK STORE UYGULAMASI

TSOFT FACEBOOK STORE UYGULAMASI TSOFT FACEBOOK STORE UYGULAMASI GEREKSİNİMLER VE KURULUM YARDIMI GİRİŞ Facebook, insanların arkadaşlarıyla iletişim kurmasını ve bilgi alış verişi yapmasını amaçlayan bir sosyal paylaşım web sitesidir,

Detaylı

DİJİTAL PAZARLAMA. İnternet çağının yeni pazarlama yöntemi

DİJİTAL PAZARLAMA. İnternet çağının yeni pazarlama yöntemi DİJİTAL PAZARLAMA İnternet çağının yeni pazarlama yöntemi DİJİTAL ÇAĞ Dijitalleşme süreci internetin günlük hayatımıza girmesi ile başladı. Bu ilk dönemde şirketler tek taraflı iletişim sağlayan kurumsal

Detaylı

Doğru tercihleri kariyersite de bulabilirsin. MomentSoft Bilişim Hizmetleri A. Ş. 2014

Doğru tercihleri kariyersite de bulabilirsin. MomentSoft Bilişim Hizmetleri A. Ş. 2014 Doğru tercihleri kariyersite de bulabilirsin 2014 İzlenecek yol Sistemi nasıl kullanıırm? 1 2 Üye ol Profil oluştur 3 Mobil ödeme yap 4 Puanına uygun tercih kriterlerini belirle 5 Tercih grubunu oluştur

Detaylı

Sosyal medya üzerinden yapılan kişisel bir bilginin Bir Tıkla paylaşılması ile o bilginin ulaşabileceği kitleler ve hiçbir şekilde silinemeyeceği

Sosyal medya üzerinden yapılan kişisel bir bilginin Bir Tıkla paylaşılması ile o bilginin ulaşabileceği kitleler ve hiçbir şekilde silinemeyeceği SOSYAL MEDYA Hiç şüphesiz gelişen ve küreselleşen dünyanın en önemli parçası internettir. İnternetin artık günümüzde kullanılmadığı bir alan neredeyse kalmadı diyebiliriz. Özellikle sosyal ağların kullanım

Detaylı

İSTANBUL AYDIN ÜNİVERSİTESİ ONLINE EĞİTİM BİRİMİ. Online Derslere Giriş Kılavuzu

İSTANBUL AYDIN ÜNİVERSİTESİ ONLINE EĞİTİM BİRİMİ. Online Derslere Giriş Kılavuzu İSTANBUL AYDIN ÜNİVERSİTESİ ONLINE EĞİTİM BİRİMİ Online Derslere Giriş Kılavuzu Dersleri izlemek için lütfen aşağıdaki adımları takip ediniz. 1. AYSIS teki Online Derslerim sayfasında yer alan geçiş bağlantısı

Detaylı

Mahaya Bulmaca Sözlük 1.0

Mahaya Bulmaca Sözlük 1.0 Mahaya Bulmaca Sözlük 1.0 1 / 16 Table of contents Mahaya Bulmaca Sözlük'e Hoşgeldiniz... 3 Özellikler... 3 Lisans... 4 Kullanmaya Başlayın... 5 MBS'ü Başlatmak... 5 Yardım Almak... 5 Sistem Gereksinimleri...

Detaylı

Mevlana Üniversitesi Uzaktan Eğitim Uygulama ve Araştırma Merkezi (MEVUZEM) MYENOCTA Uzaktan Eğitim Sistemi Öğrenci Kullanım Kılavuzu

Mevlana Üniversitesi Uzaktan Eğitim Uygulama ve Araştırma Merkezi (MEVUZEM) MYENOCTA Uzaktan Eğitim Sistemi Öğrenci Kullanım Kılavuzu Mevlana Üniversitesi Uzaktan Eğitim Uygulama ve Araştırma Merkezi (MEVUZEM) MYENOCTA Uzaktan Eğitim Sistemi Öğrenci Kullanım Kılavuzu Konya, 2015 ENOCTA sisteme giriş: 1. Web tarayıcınızın adres çubuğuna

Detaylı

III. ISTANBUL CARBON SUMMIT III. İSTANBUL KARBON ZİRVESİ 14-15 April 2016 14-15 Nisan 2016

III. ISTANBUL CARBON SUMMIT III. İSTANBUL KARBON ZİRVESİ 14-15 April 2016 14-15 Nisan 2016 III. ISTANBUL CARBON SUMMIT III. İSTANBUL KARBON ZİRVESİ 14-15 April 2016 14-15 Nisan 2016 www.istanbulcarbonsummit.org ULUSLARARASI DESTEKÇİ Uluslararası Emisyon Ticareti Derneği II. İSTANBUL KARBON ZİRVESİNDEN

Detaylı

KİŞİSEL "GÜÇ KİTABINIZ" Güçlenin!

KİŞİSEL GÜÇ KİTABINIZ Güçlenin! KİŞİSEL "GÜÇ KİTABINIZ" Güçlenin! Hangi alanlarda başarılıyım? Ne yapacağım? Okul hayatınız bittiğinde, önünüze gerçekleştirebileceğiniz çok sayıda fırsat çıkar. Kendi iş yerlerini açan insanların ne tür

Detaylı

Katılımcı Portalı Kullanım Kılavuzu yatırımınızdan daha fazlasını almak için en etkili araç

Katılımcı Portalı Kullanım Kılavuzu yatırımınızdan daha fazlasını almak için en etkili araç Katılımcı Portalı Kullanım Kılavuzu yatırımınızdan daha fazlasını almak için en etkili araç Rakiplerinizden bir adım önde olun Profiliniz ile dikkat çekin Performansınızı ölçün İçerik Oturumunuzu açın

Detaylı

25 Haziran 2014 DenizBank Güncel Haber Bülteni

25 Haziran 2014 DenizBank Güncel Haber Bülteni 25 Haziran 2014 DenizBank Güncel Haber Bülteni Yapı Kredi nin Vine Kampanyası Mobil Şube ye Olan İlgiyi İkiye Katladı Vine, bir yanda kendi trendlerini ve fenomenlerini yaratmaya devam ederken diğer yanda

Detaylı

AKINSOFT OfficeMessenger

AKINSOFT OfficeMessenger AKINSOFT Yardım Dosyası Doküman Versiyon : 1.01.01 Tarih : 20.01.2011 Sayfa-1 1- ÇALIŞMA ŞEKLİ HAKKINDA KISA BİLGİ Yerel ağlarda (ofis veya ev) veya internet üzerinden (E-Ofis programı entegrasyonu sayesinde)

Detaylı

UZAKTAN EĞİTİM MERKEZİ ÖĞRENİM YÖNETİM SİSTEMİ KULLANIM KILAVUZU

UZAKTAN EĞİTİM MERKEZİ ÖĞRENİM YÖNETİM SİSTEMİ KULLANIM KILAVUZU NAMIK KEMAL ÜNİVERSİTESİ UZAKTAN EĞİTİM MERKEZİ ÖĞRENİM YÖNETİM SİSTEMİ (LMS-LEARNING MANAGEMENT SYSTEM) KULLANIM KILAVUZU 2014 İÇERİK Uzaktan Eğitim Merkezi Hakkında Genel Bilgi... 3 Uzaktan Eğitim Merkezi

Detaylı

MEBWEB OKUL/KURUM WEB SİTELERİ KULLANIM KLAVUZU TEMEL İŞLEMLER

MEBWEB OKUL/KURUM WEB SİTELERİ KULLANIM KLAVUZU TEMEL İŞLEMLER MEBWEB OKUL/KURUM WEB SİTELERİ KULLANIM KLAVUZU TEMEL İŞLEMLER 1.WEB PANELE GİRİŞ www.okuladı.meb.k12.tr/mebpanel Resim1: Okul Web Siteleri Yönetim Paneli [MebWeb] Giriş Ekranı AÇIKLAMA: Okulunuzun web

Detaylı

3- http://www.google.com/sites/help/intl/tr/overview.html

3- http://www.google.com/sites/help/intl/tr/overview.html Merhaba değerli öğrencilerim, Son ödevin konusu : Kişisel web sitesi oluşturmak, siteyi düzenlemek, yayınlamak ve UKEY üzerinden bir dosya içerisinde kişisel web sitesinin adresini göndermek. Bunun için

Detaylı

İzmir Ekonomi Üniversitesi Görsel İletişim Tasarımı Bölümü

İzmir Ekonomi Üniversitesi Görsel İletişim Tasarımı Bölümü İzmir Ekonomi Üniversitesi Görsel İletişim Tasarımı Bölümü İZMİR EKONOMİ ÜNİVERSİTESİ GÖRSEL İLETİŞİM TASARIMI BÖLÜMÜ Günün Menüsü Görsel İletişim Tasarımı nedir? Görsel İletişim Tasarımcısı ne yapar?

Detaylı

TÜRKİYE MÜZİK VE DANS FUARI 2015 08-11.10.2015. Müzik, Dans ve Sahne Ekipmanları, Etkinlik Organizasyonu ve İletișim Teknolojileri Fuarı ORGANİZATÖR

TÜRKİYE MÜZİK VE DANS FUARI 2015 08-11.10.2015. Müzik, Dans ve Sahne Ekipmanları, Etkinlik Organizasyonu ve İletișim Teknolojileri Fuarı ORGANİZATÖR TÜRKİYE MÜZİK VE DANS FUARI 2015 08-11.10.2015 Müzik, Dans ve Sahne Ekipmanları, Etkinlik Organizasyonu ve İletișim Teknolojileri Fuarı ORGANİZATÖR HKF FUARCILIK A.Ș. Barbaros Bulvarı 163/2 34349 Beșiktaș/

Detaylı

YENİ AKOFİS, MÜŞTERİ SİPARİŞ YÖNETİMİ

YENİ AKOFİS, MÜŞTERİ SİPARİŞ YÖNETİMİ YENİ AKOFİS, MÜŞTERİ SİPARİŞ YÖNETİMİ Bu sunum; yeni sitemizde siz müşterilerimizin siparişlerini nasıl yönetebileceğinizi anlatmak üzere hazırlanmıştır. Siteye Giriş Siteye üye girişi yapmak için ana

Detaylı