Andromeda Botnet Analizi

Ebat: px
Şu sayfadan göstermeyi başlat:

Download "Andromeda Botnet Analizi"


1 AndromedaBotnetAnalizi 1. Giriş 2. Anomaliler 3. DinamikAnaliz 4. StatikAnaliz 5. ProtokolAnalizi 6. ConfigDosyalarıveHedeflerinİncelenmesi 7. Sonuç EmreTINAZTEPE

2 Giriş 20AralıktarihindenitibarenNetSecmailinglistesindenTurkcell dengeliyormuşgibigörünenveeklerindezararlıyazılım olduğubelirtilenbazıe postalaralmayabaşladık.24aralıktarihindeisebenzerolaylarınfarklıfirmaisimleriile tekrarlandığınıgördük.aynıtarihtetwittergibisosyalpaylaşımplatformlarındaaşağıdakinebenzergörüntülerpaylaşılmaya başladı. Başlangıçtadikkatimiziçekmesedeaynıiçeriğebenzere postalarınthy'dengeliyormuşgibigönderilmesi,bunun düşündüğümüzgibi basit birspamkampanyasıdeğilçokdahabüyükbirorganizasyonunyüzeydekikısmıolduğunubelli edergibiydi. ElimizdeTurkish Airlines Itinerary.pdf.exeveFaturaBildirimi pdf.exeolarakisimlendirilmişikiörnek bulunmaktaydı.ikiörneğindeaynımd5hash e(c7c39fea16c34d867b586fd155dca77a)sahipolduğunugördük.örneklerin VirusTotaltespitoranınındaepeydüşükolmasıdikkatçekiciydi.TanıyanAV lerdetambirtanımvermekyerinedosyayı şüpheliolarakişaretlemişlerdi.

3 Anomaliler Dosyayısanalmakineyeatarakdinamikanaliziçinhazırlıkyapmayabaşladığımızdaaşağıdakianomalilerdikkatimiziçekti: Dosyanınbağımlılık(dependency)listesinebakıldığındaanlamsızharflerdenoluşanbirDLLolması, Normalşartlaraltındasadece okunabilir(read only) olmasıgereken.rdatasection ın yazılabilir oluşuve isminingaripkarakterlerbarındırması, Hiçbirresourceiçermemesi, Çokazsayıdaimportiçermesivenormaluygulamalardapekderastlamayaalışıkolmadığımızbazıimportlar içermesi, İçerisindebulunanmetinlerinşifrelibirgörünümsergiliyorolması. DinamikAnaliz Networkbağlantısıolmayan undetected birsanalmakinededinamikanalizebaşladığımızdadosyanınkendisini yenidenbaşlatmayaçalıştığınıgözlemledik. Butipbirhareketdosyanınpaketlenmişiçeriktaşıdığınıngöstergesiolabileceğigibiolasıdebuggerlar dan kurtulmakistemesinindebirgöstergesiolabilirdi.hemenarkasındanwuauclt.exe(windowsupdate)dosyasınınbaşlatılıyor olmasıunderground da matruşka olaraktabiredilentekniğiandırıyordu.

4 Buandanitibarençıkandosyalarıunpacketmeyevesanalmakineninanamakineilepaylaşılanklasörünekopyalamaya başladık.3 ncüadımdaçalıştırılanwuauclt.exedosyasızincirinsonhalkasınıoluşturuyordu. wuauclt.exesürecini,processexplorerileincelediğimizdesessizliğinsebebininnetworkbağlantısınınolmamasıolduğu apaçıkbelliydi Testlerimizenetworkbağlantısınıaçarakdevamettiğimizdesözkonusuadımlarınaynışekildetekrarladığınıfakatbusefer explorer.exeiçerisindeyenithreadleryaratılarakenollo.pladresinebağlanıldığınıgözlemledik. Giden/gelentrafiğiincelediğimizde,tümtrafiğinşifreliolduğuaşikardı. Trafiği,BurpSuiteileC&Csunucusuna forward ettiğimizdezararlınınyeniuygulamalarindirerekçalıştırmayabaşladığını gözlemledik.yeniindirilenbazıdosyalarındaaynı matruşka tekniğiileçalışmasıvekendileriniyenidenbaşlatarak kontrolübirsonrakiaşamayadevretmesidikkatedeğerdi. TümbuaşamalardacaptureettiğimiznetworkpaketleriilerleyengünlerdeC&Csunucularınınkapanmasıüzerinelab ortamındac&csunucularınısimüleetmemizikolaylaştırdı.ilerleyenbölümlerdebukonuyadadeğineceğiz. DinamikanalizitamamlamakiçinRegShotilesistemdeyaptığıdeğişikliklerigözlemlediğimizdeaşağıdakideğişikliklerinot ettik:

5 Oluşturulanikidosyada,e postaeklentisiilegelendosyanınbirebiraynısıydı. StatikAnaliz Dinamikanalizsafhasınıgeçerek maileklentisi olarakgelendosyayıidaileincelemeyebaşladık.dosyayıaçaraçmaz aldığımızilkhatavemüteakibengördüğümüz SP Analysisfailed hatasıanti debug/anti trace/anti vmgibidahabirçok şeyinbirazdanbaşlayacağınınbelirtisiydi.özelliklestackpointeranalizinbaşarısızolması,kodureverseederkenanalisteçok işdüşeceğinigösterirkigerçektendebeklediğimizgibioldu.koduntraceedilmesivekritikbloklarınbulunmasıepey zamanımızıaldı. KodiçerisindegördüğümüzbirçokMOVDWORDPTRSS:[ESP]instruction ıgccilederlenenbiruygulamaolmasıihtimalini güçlendiriyorduyadatamamenassemblerileyazılmışbirdownloaderilekarşıkarşıyaydık. İlkdallanmadanitibarengördüğümüzSetUnhandledExceptionFilterAPIsi,birkaçdakikaiçindeanti debugrutinleriile karşılaşmayabaşlayacağımızınaçıkgöstergesiydi.buapi,windows toplevelexceptionhandler ıdeğiştirmekiçin kullanıldığıgibiaynızamandadaçokkullanılanbiranti debugyöntemidir.nedeninegelince,processiçerisindeçalışan thread lerdenherhangibirisininunhandledbirexceptionilekarşılaşmasıdurumundaancakveancakprocess Debug edilmiyorsabufiltreçağırılırvedöndürdüğüdeğeregöreexceptionhandlerkontrolüdevralır.eğerprocessdebugediliyorsa bufiltrehiçbirzamançağırılmazvekontroldebugger adevredilerekexceptionıfixetmesibeklenir,dolayısıylaişlembir sonrakiinstructiondandevameder. BuradaFNINITiledesteklenenveişlemcininexceptionflaglarınısilerekilerleyen novel diyebileceğimizbirteknikkullanılmış. HernekadarIDAStealthgibiantianti debugpluginleriilegeçilebilsedegayetgüçlübirteknikolduğunubelirtmeden geçemeyeceğiz. İlerleyenkısımlardaikiRDTSCinstruction ıarasındageçensüreyedayandırılmışbiranti Debugmetodutespitettiğimizi düşündük.aslındabaşlangıçtabununsadeceanti Debugmetoduolduğunudüşündüğümüziçinçiftdalıdakontroletmek yerinetekdaldandevamettik.budabazıforumvesandboxraporlarındayazdığıüzerezararlının 8000 portunudinleyip bağlananashellverdiğidalınbukısımolduğunufarketmemizilesonuçlandı.bizimleaynıandaanalizyapanarkadaşımız MertSARICAilegörüşmemizdeAnti DebugolarakdüşündüğümüzkısmındahaçokAnti Emulatorolaraktasarlandığını anlamışolduk.

6 ZararlınıngövdesininçokbüyükbirkısmıXORileşifrelenmişdurumdaydı.Ençokdikkatimiziçekenkısımiseçalışacakolan kodparçalarınınçokküçükbloklarhalindeçözülerekçalıştırılmasıydı.dolayısıylakodunbüyükkısmınındecryptedilmesiiçin traceetmeyebaşladık.aşağıdakigörüntüdendeanlayacağınızgibibazıbölümler38baytlıkhattadahadaküçükbloklar halindeşifrelenmişti. ZararlınıntraceedilmekorkusuilekendiGetProcAddressimplementasyonunuyaptığınıfarketmemizilekoduntraceedilme hızıepeyarttı.bufonksiyonudahakolaytakipedebilmekiçinvx_getprocaddressolarakadlandırdık. Çokgeçmedenaşağıdakigörüntüyügördüğümüzde,ikincisafahanınbaşlamaküzereolduğunuvekullanılantekniğinRunPE olduğunuanlamıştık. AşağıdaPhase1.exe nin(e postaeklentisi)kendisiniyenidenbaşlatarak3888id liyeniprocess inhafızasınaunpackedilmiş kodlarıyazdıktansonrakihalinigörüyorsunuz.

7 Yenikopyanınçalışırçalışmazaşağıdakikontrollerigerçekleştirdiğinigözlemledik: Sistemdeçalışanprocessisimlerininhashlerinialarakaşağıdakilisteilekarşılaştırdığını, (BuhashlerinnelerolduğunuMertSARICA nınbloğundanöğrenebilirsiniz) ProcessenümerasyonununbaşarısızolmasıdurumundaGetModuleHandle( sbiedll.dll )çağrısıilesandboxie DLL ininvarlığınıtespitetmeyeçalıştığı,vebunuyaparkenstack edword lerşeklindepushederekstring oluşturduğu,(buyöntemzararlınınenazındanbukısmınınasmileyazıldığınınispatıydı) HemenarkasındansanalmakinevediskidkontrolüyaparaksonbirRDTSCdeltakontrolüyaptığı. Bukontrollerdenbaşarıilegeçilmesidurumunda: 32bitsistemlerde\System32\wuauclt.exe(WindowsUpdate), 64bitsistemlerdeise\SysWOW64\svchost.exe(ServiceHost). Pekinedenbuprocessler?Neden32ve64bitsistemlerdefarklıuygulamalarhostolarakseçiliyordiyesoracakolursanız; cevapikiuygulamanında32bitoluşu.zararlı3 üncüfazıbuuygulamalardanbirisininiçindegerçekleştirecekveiçlerine yalnızca32bitkodenjekteedebilmeyeteneğinesahip,cabasıbuuygulamalar,birçokfirewalltarafındanotomatikizin verilenvetümmimarilerdebulunanuygulamalar.

8 Bunoktadawuauclt.exeSUSPENDEDolarakbaşlatılarakgereklihafızamodifikasyonlarıyapılarak3 üncüaşamayageçildiğini gördük.buaşamadaözellikleanti Debugmetodlarındaçokfazlacabirartışgözleniyordu.Aslındabu,anasaldırımihverinin birgöstergesiydi. BununyanısıraaşağıdakiresimdegörebileceğinizgibiçokfazlakullanılmayanbaşkabiryöntemileExitThreadAPIsi kancalanarakkontrolünthreadsonlanmasınamüteakipzararlıyageçmesisağlanmıştı.bunoktadanitibarenkernel Debugger(WinDBG)iledevamederek3 üncüfazınanalizinegeçtik. 3 üncüfazınesasgörevidahaönceyapmışolduğumuzdinamikanalizdengördüğümüzkadarıylazararlınınc&cbağlantısını sağlamakveyenizararlılarıdownloadetmekti.kodundecryptedilmesiiçinuzunbirsüretraceettiktensonrainternet bağlantısınıkontroletmekiçinkullanılanaşağıdakiwindowsupdateadresinibulduk.

9 İlerleyensüreçtedinamikanalizsafhasındagördüğümüzmoid.plvelinebench.ruadresleriilekarşılaştık.Burada gördüğümüzdizilim,ö yeeğerbağlantıkurulamaziselinebench.ruvesırasıyladiğeradreslerebağlanmaya çalışılmasınıaçıklıyordu. ProtokolAnalizi AnalizindevamındaprotokolanalizinebaşladıkvebuadreslerePOSTmetoduilegönderilenaşağıdakiveriyeulaştık.Sırabu verininneifadeettiğinibulmayagelmişti.burpsuiteiletrafiğiinterceptedipnetworkfonksiyonlarınayoğunlaşmaya başladığımızdakodçokdahaanlaşılırbirhalebürünmeyebaşlamıştıbile. KodiçerisindeXORveRORlardanoluşanbirkaçencrypt/decrpytfonksiyonutespitettikvebukısımlaraolanreferansları incelemeyebaşladık.socketfonksiyonlarındanrecv/sendfonksiyonlarınayoğunlaşıryoğunlaşmazkarşımızabiranda Base64olduğubarizbelliolanbaşkabirfonksiyonçıktı.HemenarkasındandaRC4 eçokbenzeyenbaşkabirfonksiyondaha tespitettik. Buandanitibarendahaçokzararlınınkullandığıprotokoleyoğunlaşmayabaşladıkve7adetkomutun(update,execute, downloadvb.)desteklendiğinigördük.aşağıdakomutlarınişlendiğiswitch igörebilirsiniz.bugörüntüaslındabiryanılgının dacevabıydı: Phase1 denbuyanaaslındapackedbirdownloaderdeğil,tamkapasitelibirbotilekarşıkarşıyaydıkve görünüşegörehikayehenüzyenibaşlıyordu

10 Command9:DeleteBot Command1:DownloadandExec Kısabirsüresonrakarşımızdakimanzaraaşağıdakigibiydi: BirsüresonraBotProtocolString deyeralangirdilerinhangiinputlarkullanılarakoluşturulduğunuaraştırmayakoyulduk. Sunucuyagidenisteklerdeuzuncevap,sunucudangelentaleplerdeisekısacevapkullanılıyordu.Kısabirsüresonra yaptığımızaraştırmaçokgüzelmeyvelervermeyebaşlamıştıbile.botbaştadatahminettiğimizgibirc4kullanıyorduve formatstringiniçeriğiaşağıdakigibiydi.

11 Andromeda(W32.Gamarue)aslındabaşındanberikarşımızdaduruyordufakathiçbirAV deböylebirismeratlamamıştık. Bunoktada,protokoldekullanılanformatıgörürgörmezzararlınınAndromedaolduğunuanlayanekiparkadaşımErkan ARNAUDOV unyönlendirmesisüreciçokhızlandırdı.bot unadınıveyeteneklerinidahaderinlemesineincelediktensonra, sırasistemeindirmeyeçalıştığıyenizararlılarınnelerolduğunuanlamayagelmişti. Çalışmamızınbaşındadinamikanalizesnasındabirçokzararlıindirildiğindenbahsetmiştik.BunlarbaşlangıçtaZeuS/Zbot imzasıtaşıyanzararlılarolmaklabirlikte,müteakipdenemelerdefarklıdavranışlarsergileyenzararlılardownloadedildiğini gözlemledik.bunlardanözelliklekbxxxxxx.exeşeklindedosyalaroluşturanvesslhookatmamasıilezeus danayrılanbaşka birzararlıdahaolmasındanşüphelendik.tübitakbilgem inyayınladığırapordabunudoğrularnitelikteydi. Dolayısıylakarşıkarşıyaolduğumuzdurumaşağıdakigibiydi: ConfigDosyalarıveHedeflerinİncelenmesi ZeuSveCridexikilisibankertrojanlarolup,configdosyalarıolmadançokdaişeyaramayanzararlılardır.Ayrıldıklarınokta Cridex inconfigdosyasınıncleartextolmasıvenetworktrafiğidinlenerekcaptureedilebilmesidir.aksine,zeusencrypted birconfigdosyasınasahiptirvepiyasadaconfigdosyasınıextractedebilentoolsayısıçokazdır.bilgem denosmanpamuk venecatiersenşişeci nincridexanaliziniokuduktansonrakendisistemimizdebuzararlıyıçalıştırarakbizdedeaynıconfig parametreleriniindiripindirmediğinitestetmekistedik.çünkügörünüşegöre,zararlı,pc denpc yefarklıdavranabiliyordu vebufarklılıkconfigdosyasınadayansıyabilirdi.sanalmakinedeçalıştırdığımızcridexörneğilohtikr.ruadresindenaşağıdaki birçokbankayıiçerenbirconfigdosyasınıdownloadetti.

12 Şunudabelirtmedengeçmemeliyiz,configdosyasındakitoplambankasayısıTürkbankasısayısınınenaz15 20katıydıve adınıbileduymadığımızbirsürübankailekarşıkarşıyaydık. Cridex inconfigdosyasınıextractetmeyemüteakipsırazeus unconfigdosyasınınextractedilmesingelmişti.phase1de elimizegeçenörneğianalizetmekistediğimizdec&csunucuların5ininkapalıolduğunugördük.maalesefaçıkolansunucu dabizezeusyerinecridexpushetmeyebaşlamıştı.dolayısıylamailekiilegelenzararlı(andromeda)artıkzeusanaliziiçin kullanılamıyordu.bunoktada4 ncüfazdacaptureettiğimizzeussample ınısanalmakineyekopyalayıpcaptureedilen networkloglarınıincelemeyekoyuldukvesample ınbağlanmayaçalıştığıenollo.plsunucusunuhostsdosyasınaekleyerek anamakinemizdeçalışanapachesunucusunayönlendirdik. Yapmamızgerekentekşeyzararlıdangelenrequest e,c&csunucusuymuşgibicevapveriphenüzneolduğubelliolmayan fakat%99.99encryptedconfigdosyasıolanpipta.bindosyasınıalmasınısağlamaktı.bununiçinaşağıdakiphpscriptini flowers.phpadıylakaydetmemizyeterlioldu.herihtimalekarşı7saniyelikbirbeklemeyarattıkkibusüredesnapshotalma, debuggerattachetmegibiişlemleriçingerekliolabilirdi. C& Apache2:

13 BuaşamadanitibarenZeuSdışdünyasındantamamensoyutlanmışbirhaldelabortamımızdaçalışırhaldeydi. KoduAPIMonitoriletraceetmeyebaşladığımızda16KB lıkdosyayıtoplamda4internetreadfileçağrısıyaparak okuduğunutespitettik.beklemeyiistersunucutarafındaistersekdeclienttarafındagerçekleştirebilir,dilediğimizgibi dosyanınhafızayayüklenişiniizleyebilirdik.ikinciyaklaşımdahaesnekolduğuiçinapimonitorileinternetreadfileçağrısına breakpointkoyarak BreakAfter seçeneğiniişaretledik.zeus uniçerisinekodenjekteettiğiexplorer.exesahtec&c sunucusunabağlanarakşifrelenmişconfigdosyasınıtalepetti. 4 üncüçağrıyıdevamettirmedenhemenöncekerneldebuggerilebuffer ınbulunduğuadresebirhardwarebreakpoint koyduk.aradançokdazamangeçmedenzeusconfigdosyasıilebaşbaşaydık.

14 Buandanitibarendosyanınboyutuolan0x3F87sayısınaodaklanmayabaşladık.Keyiflibirtracedensonraaşağıdakimanzara ilekarşıkarşıyaydık: Adresedikkatedecekolursanız,şifrelipipta.bindosyamızınhafızadaaçılmayabaşladığınıgörebilirsiniz. PekiURL lergayetnetgörünmekteiken,nedenaltkısımdagörünenmetinlersankikarıştırılmışgibiydi?acabaheap debir adresebakıyordukdafarkındamıdeğildikyoksabuadrespipta.bin inyüklendiğiadresmiydi?takendisiydifakatbirsorun olduğuapaçıkbelliydi. BunoktadakoduniçinedahafazlagirmemekiçinZeuSdecryptorlarıaraştırmayabaşladıkvePCToolstarafındanyayınlanmış ConfigDecrpytoraracınıbuldukfakatoutdatebirtoololduğuiçinbuaraçtandabirsonuçalamadık

15 Yineişbaşadüşmüştü,configdosyasınınaslındasadeceencryptedolmadığını,aynızamandadacompressedolduğunu anlamamızlahemenkendizeusconfigviewer ımızıyazmayakoyulduk. ConfigdosyasınınformatınıaraştırmamızveZeuSkaynakkodlarınıincelememizileformatınaşağıdakigibiolduğunutespit ettik. Bubilgilerışığındaelimizdekidecrpytedconfigdosyasınıdecompressedebilecekbirtooluhazırlamamızçokdauzunsürmedi. AşağıdakiresimdedecompressedilmişC&Csunuculistesinigörebilirsiniz.Aracıburadanindirebilirsiniz.

16 Configdosyasındançıkardığımızsunucularaşağıdakigibiydi: Pekihedefalınanbankalarhangileriydi?GaripfakatCridexconfigdosyasındagördüğümüzyüzlercebankanınyanındaZeuS configdosyasındasadeceaşağıdakibankalarhedefalınmıştı Sonuç Sistemlibirsaldırıyaşahitolduk.Analizimizboyuncafarklıtrojanlarvehedeflerarasındanençokdikkatimiziçekenşey NetSECmailinglistesindenteminettiğimizXTremeRATörneğiiçeren kadarincelediğimizörneklerarasındaxtremerat ınc&csunucularıtarafındanpushedildiğinerastlamamışolsakda, yazımızdadahaöncedebelirttiğimizgibienfekteedilensisteminözelliklerinehattavehattaülkelerinegörezararlıpush edebilecekbiryapıyasahipoluşubüyükbirşüpheyiuyandırmayayetiyordu İşinucundaXTremeRATolduğunuduymakaçıkçasıkorkutucuyduçünküaynıRATkomşuülkeleredüzenlenenbazısiber saldırılardakullanılmıştıvebusaldırıdadakullananherkimse kredikartı hırsızlığındandahabüyükbirhedefiolduğu

17 aşikardı Nedenderseniz,buzararlıbankertrojandenziyadedahaçokdinleme/izlemeamaçlıkullanılanveaudiocapture özelliğiilegözeçarpanbirtrojan. İlgiliadrestenindirdiğimiztrojan itestettiğimizdekarşımızaçıkanikiadetipvedomain insatınalındığıhostingproviderın Türkiye deoluşu,üstüneüstlükadresinvodafone3gipbloğundanalınmışolması,alışverişmerkezininbirindeoturmuş mobilmodemiilebağlandığıc&csunucusunabakarakkahvesiniyudumlayanbirkorsanıaklımızagetiriyordu. Konuileilgiliarzuedenresmikurumlaraaraştırmadakullandığımızhertürlüdökümanısağlamayahazırız.Bukonudadetaylı

2 3 Generated by Foxit PDF Creator Foxit Software For evaluation only. Generated by Foxit PDF Creator Foxit Software For evaluation only.


«BM364» Veritabanı Uygulamaları

«BM364» Veritabanı Uygulamaları HAFTA 8 DB içerisinde CLR Bileşenleri" Yaşar GÖZÜDELİ «BM364» Veritabanı Uygulamaları Konu Akışı SQL Server CLR SQL Server içerisinde


Limit Oyunları. Ufuk Sevim 10 Ekim 2012

Limit Oyunları. Ufuk Sevim 10 Ekim 2012 Limit Oyunları Ufuk Sevim 10 Ekim 2012 1 Giriş Limit ve sonsuzluk kavramlarının anlaşılması birçok insan için zor olabilir. Hatta bazı garip örnekler bu anlaşılması zor kavramlar


Gönderilen uygulama incelendiğinde, belirtilen gerekliliklerin bir kısmının karşılandığı görülmüştür.

Gönderilen uygulama incelendiğinde, belirtilen gerekliliklerin bir kısmının karşılandığı görülmüştür. İsim : İlker **** Soyad : K****** Değerlendirilme tarihi : 09.05.2014 Karşılıklı görüşme tarihi : 08.05.2014 Alanı : Backend Java Değerlendirme yorumu: Gönderilen uygulama incelendiğinde, belirtilen gerekliliklerin



446 GÖMÜLÜ SİSTEM TASARIMI. Lab 9 UART 446 GÖMÜLÜ SİSTEM TASARIMI Lab 9 UART 9.1 Amaç Bu laboratuvarda LaunchPad ve bilgisayar arasında seri haberleşme gerçekleştirilecektir. Bunun için TExaSdisplay terminal programı kullanılacaktır. UART0


Adım Motoru: açıya adım. Şekil 8.2 tekyönlü. Lab 8. Siyah (A) Mavi ( B ) Kırmızı (B)

Adım Motoru: açıya adım. Şekil 8.2 tekyönlü. Lab 8. Siyah (A) Mavi ( B ) Kırmızı (B) 446 GÖMÜLÜ SİSTEM TASARIMI Adım Motoru 8.1 Amaç Bu laboratuvarda LauchPad a dışarıdan bağlanacak adım motorunun dönme yönünü ve hızını kontrol eden programın yazılımı verilecektir. 8.2 Gerekli Malzeme



BÖLÜM 24 PAULI SPİN MATRİSLERİ BÖLÜM 24 PAULI SPİN MATRİSLERİ Elektron spini için dalga fonksiyonlarını tanımlamak biraz kullanışsız görünüyor. Çünkü elektron, 3B uzayda dönmek yerine sadece kendi berlirlediği bir rotada dönüyor. Elektron



TEMEL BİLGİSAYAR BİLİMLERİ TEMEL BİLGİSAYAR BİLİMLERİ Doç. Dr. M.Ümit GÜMÜŞAY YTÜ - 2012 2 PROGRAMLAMA MANTIĞI Herhangi bir amaç için hazırlanan programın mantık hataları içermesi durumunda, alınacak sonucunda yanlış olacağı aşikardır.


REKABET. Tüketicinin rekabetteki kaldıraç etkisi. Fulya DURMUŞ, GfK Türkiye

REKABET. Tüketicinin rekabetteki kaldıraç etkisi. Fulya DURMUŞ, GfK Türkiye REKABET Tüketicinin rekabetteki kaldıraç etkisi Fulya DURMUŞ, GfK Türkiye 1 Hemen her ürüne, markaya her yerden ulaşabiliyoruz Ben yine çarşıdaki ayakkabıcıya gideyim Biliyorum o telefonu istiyorsun ama


9.Konu Lineer bağımsızlık, taban, boyut Germe. 9.1.Tanım: V vektör uzayının her bir elemanı

9.Konu Lineer bağımsızlık, taban, boyut Germe. 9.1.Tanım: V vektör uzayının her bir elemanı 9.Konu Lineer bağımsızlık, taban, boyut 9.1. Germe 9.1.Tanım: V vektör uzayının her bir elemanı vektörlerin lineer birleşimi olarak ifade ediliyorsa vektörleri V yi geriyor ya da V yi gerer denir. Üstelik,


.com. Kurumsal Java. Özcan Acar 2009. com

.com. Kurumsal Java. Özcan Acar 2009. com . urumsal J Java ile Yüksek Performanslı Web Platformları Özcan Acar http://www.ozcanacar. http://www.kurumsalj urumsal Özcan Acar Hakkında public class OezcanAcar { public static


1-Kullanılan malzeme; ipek ip, ipek kumaştır. -Tamamı el nakışıdır. - Hesap işi tekniği uygulanmıştır. -3 parçadan oluşan oda takımı örtüsüdür.

1-Kullanılan malzeme; ipek ip, ipek kumaştır. -Tamamı el nakışıdır. - Hesap işi tekniği uygulanmıştır. -3 parçadan oluşan oda takımı örtüsüdür. 1-Kullanılan malzeme; ipek ip, ipek kumaştır. - Hesap işi tekniği uygulanmıştır. -3 parçadan oluşan oda takımı örtüsüdür. 1-Production material: Silk thread, silk fabric. - Hesap işi technique is -Suite


Üst Düzey Programlama

Üst Düzey Programlama Üst Düzey Programlama Servlet Üst Düzey Programlama-ders01/ 1 Servlet Nedir? Web sayfaları ilk başlarda durağan bir yapıya sahipti ve kullanıcıdan bilgi alarak işlemler yapmıyordu. Zamanın geçmesiyle kullanıcıya



SMSOKUL KULLANIM KILAVUZU V. 1.0 SMSOKUL KULLANIM KILAVUZU V. 1.0 Smsokul Kullanım Ekranı Gönderilebilecek sms miktarı Okul bilgileri güncelleme butonu Sms okul yapılan havale bildirimi Sistemden Çıkış Yapmak için kullanılır. 1 adet cep



ALB FOREX GÜNLÜK BÜLTEN EUR/USD GBP/USD USD/JPY USD/TRY ALTIN GÜMÜŞ Parite EUR/USD GBP/USD USD/JPY USD/TRY ALTIN GÜMÜŞ Açılış 1,2856 1,5159 94,51 1,8132 1599,95 28,76 Yüksek 1,2866 1,5180 94,90 1,8223 1608,4


WEB SUNUCU GÜVENLİĞİ: Web Siteleri Neden Hacklenir?

WEB SUNUCU GÜVENLİĞİ: Web Siteleri Neden Hacklenir? WEB SUNUCU GÜVENLİĞİ: Web Siteleri Neden Hacklenir? Gereksiz yedek dosyaları Default ayarlarla gelen konfigürasyon dosyaları Yetkisi tam olarak verilmiş dosyalar ya da dosya izni kontrolü yapılmadan sunucuda



ALB FOREX GÜNLÜK BÜLTEN EUR/USD GBP/USD USD/JPY USD/TRY ALTIN GÜMÜŞ Parite EUR/USD GBP/USD USD/JPY USD/TRY ALTIN GÜMÜŞ Açılış 1,2847 1,5228 93,19 1,8043 1599,00 27,99 Yüksek 1,2877 1,5258 93,55 1,8091 1603,85

Detaylı ASP 3.0 ile gelen ASP nin büyük yükselişine benzer bir atakla, Microsoft.NET ailesinin üyelerinden ASP.Net i kullanıma sundu. ASP.Net in neler getirdiğini diğer makalelerden öğrenebilirsiniz. Bu makalede,





Windows'da çalışırken pek çok durumda bir işe başlamadan önce işletim sisteminin o işe ilişkin bilgileri depolayacağı bir alan yaratması gerekir.

Windows'da çalışırken pek çok durumda bir işe başlamadan önce işletim sisteminin o işe ilişkin bilgileri depolayacağı bir alan yaratması gerekir. Handel Kavramı: Windows'da çalışırken pek çok durumda bir işe başlamadan önce işletim sisteminin o işe ilişkin bilgileri depolayacağı bir alan yaratması gerekir. Alanın yaratıldığı bölge Windows'un kendi



1.PROGRAMLAMAYA GİRİŞ 1.PROGRAMLAMAYA GİRİŞ Bilindiği gibi internet üzerindeki statik web sayfaları ziyaretçinin interaktif olarak web sayfasını kullanmasına olanak vermemektedir. Bu yüzden etkileşimli web sayfaları oluşturmak



ALB FOREX GÜNLÜK BÜLTEN ALB FOREX GÜNLÜK BÜLTEN Parite Açılış Yüksek Düşük Kapanış Pivot / 1,3007 1,3102 1,3004 1,3082 1,3063 / GBP/ 1,5254 1,5341 1,5249 1,5320 1,5303 /JPY 99,35 99,66 98,58 99,01 99,08 GBP/



ALB FOREX GÜNLÜK BÜLTEN EUR/USD GBP/USD USD/JPY USD/TRY ALTIN GÜMÜŞ Parite EUR/USD GBP/USD USD/JPY USD/TRY ALTIN GÜMÜŞ Açılış 1,2934 1,5231 93,33 1,8021 1554,5 26,89 Yüksek 1,3039 1,5363 96,83 1,8065 1581,1


MİKROBİLGİSAYAR SİSTEMLERİ. Teknik Bilimler Meslek Yüksekokulu

MİKROBİLGİSAYAR SİSTEMLERİ. Teknik Bilimler Meslek Yüksekokulu MİKROBİLGİSAYAR SİSTEMLERİ Teknik Bilimler Meslek Yüksekokulu Dersin Amacı Mikroişlemciler Mikrodenetleyiciler PIC Mikrodenetleyiciler Micro BASIC Programlama Kullanılacak Programlar MSDOS DEBUG PROTEUS


FortiGate Data Leak Prevention

FortiGate Data Leak Prevention 2011 FortiGate [Bu dökümanda DLP () özelliğinin nasıl kullanıldığı ve ayarlarının nasıl yapılandırıldığı anlatılmıştır.] v400-build0320-rev.01 RZK Mühendislik ve Bilgisayar Sistemleri 0 FortiGate () DLP


Access Örnek Test Soruları

Access Örnek Test Soruları Access Örnek Test Soruları 1.Access te aş.den hangisi yapılabilir? a) Çizim yapılabilir b) çizim,metin,slayt gösterisi yapılabilir c) slayt gösterisi yapılabilir d) veri kaydı tutulabilir 2.Access için


Günlük Bülten 02 Mart 2015

Günlük Bülten 02 Mart 2015 Bülten 0 Mart 015 PİYASALAR Döviz Piyasası,50 seviyesinden güne başlayan USD/TL kuru, ekonomi yönetiminin geleceğine ilişkin endişeler, TCMB ye yönelik eleştiriler ve FED in faiz artışının zamanlamasına



ANDROID AÇIK AKSESUAR API & AKSESUAR GELİŞTİRME. Dr. Fatma Cemile Serçe ANDROID AÇIK AKSESUAR API & AKSESUAR GELİŞTİRME Dr. Fatma Cemile Serçe İçerik Android ve Uygulama Geliştirme Android Açık Aksesuar Aksesuar Geliştirme Kiti Aksesuar Geliştirme Ortamı Gereksinimleri Örnek



FİYAT LİSTESİ 01.01.2012 LİSTESİ KALİTE BELGELERİMİZ 2 SPIN-ON FİLTRELER SP 001 9,87 TL SP 002 / HT 33,71 TL SP 005 35,24 TL SP 006 34,23 TL SP 007 38,57 TL SP 008 / HT 58,24 TL SP 009 / M 7,01 TL SP 010 / M 8,87 TL


Yerel Okul Sunucusu Uygulama Yazılımları Prototipi

Yerel Okul Sunucusu Uygulama Yazılımları Prototipi TECHNOLOGY SOLUTIONS Yerel Okul Sunucusu Uygulama Yazılımları Prototipi Test ve Kabul Raporu TRscaler Technology Solutions 2013 A N K A R A Ü N İ V E R S İ T E S İ T E K N O L O J İ G E L İ Ş T İ R M E


Sanallaştırmada Özgür Yazılım Çözümleri. Alper YALÇINER

Sanallaştırmada Özgür Yazılım Çözümleri. Alper YALÇINER Sanallaştırmada Özgür Yazılım Çözümleri Alper YALÇINER 1 Sanallaştırma Nedir? Sanallaştırma; işletim sistemleri, sistem ya da ağ kaynakların mantıksal olarak bölünmesi veya yalıtılmasıdır.


İskonto Oranları. Ders 12 Finansal Yönetim 15.414

İskonto Oranları. Ders 12 Finansal Yönetim 15.414 İskonto Oranları Ders 12 Finansal Yönetim 15.414 Bugün İskonto oranlar SVFM kullanarak Beta ve sermaye maliyetini tahmin Okuma Brealey ve Myers, Bölüm 9 Graham ve Harvey (2000, sayfa 1-10) Tekrar SVFM


İlk Konsol Uygulamamız 2 İlk Windows Uygulamamız 9.Net Framework Yapısı 18 Neler Öğrendik 19. Veri Tipleri 24 Tanımlı Veri Tipleri 27 Basit Tipler 28

İlk Konsol Uygulamamız 2 İlk Windows Uygulamamız 9.Net Framework Yapısı 18 Neler Öğrendik 19. Veri Tipleri 24 Tanımlı Veri Tipleri 27 Basit Tipler 28 ix 1 İlk Konsol Uygulamamız 2 İlk Windows Uygulamamız 9.Net Framework Yapısı 18 Neler Öğrendik 19 23 Veri Tipleri 24 Tanımlı Veri Tipleri 27 Basit Tipler 28 Kayan Nokta Tipleri 30 Sayısal Veri Tipi Dönüşümleri


Cari Denge Tanımı. Dr.Dilek Seymen

Cari Denge Tanımı. Dr.Dilek Seymen Cari Denge Tanımı Dr.Dilek Seymen Cari Dengeyi iki farklı özdeşlikle tanımlamak mümkün, (I) Ödemeler Bilançosundaki sınıflamaya göre Cari Denge Tanımı, Cari denge mal ve hizmet ithalat ve ihracatı, net


DERS 11 PIC 16F84 ile ALT PROGRAMLARIN ve ÇEVRİM TABLOLARININ KULLANIMI İÇERİK. Alt Program Çevrim Tabloları Program Sayıcı ( Program Counter PC )

DERS 11 PIC 16F84 ile ALT PROGRAMLARIN ve ÇEVRİM TABLOLARININ KULLANIMI İÇERİK. Alt Program Çevrim Tabloları Program Sayıcı ( Program Counter PC ) DERS 11 PIC 16F84 ile ALT PROGRAMLARIN ve ÇEVRİM TABLOLARININ KULLANIMI İÇERİK Alt Program Çevrim Tabloları Program Sayıcı ( Program Counter PC ) Ders 9, Slayt 2 1 ALT PROGRAM Bir program içerisinde sıkça


Performanslı T-SQL Yazımı ve Indeks Kullanımı Üzerine Gerçek Hayat Tecrübeleri

Performanslı T-SQL Yazımı ve Indeks Kullanımı Üzerine Gerçek Hayat Tecrübeleri Performanslı T-SQL Yazımı ve Indeks Kullanımı Üzerine Gerçek Hayat Tecrübeleri Serap PARLAK 1, Dr. Deniz KILINÇ 1 1 Univera Bilgisayar Sistemleri Sanayi ve Ticaret A.Ş, İzmir 2 Univera Bilgisayar Sistemleri


R-FLEX Spotlar / Spotlights. R-FLEX Ankastre aygıtlar / Recessed luminaires (Tek çerçeve / Single frame)

R-FLEX Spotlar / Spotlights. R-FLEX Ankastre aygıtlar / Recessed luminaires (Tek çerçeve / Single frame) R-FLEX 78 R-FLEX Spotlar / Spotlights 82 Özel olarak mağaza aydınlatması için tasarlanan R-Flex serisi, LED ve metal halide lambalı spot ve ankastre versiyonları ile kullanımınıza sunulmaktadır. Daha çok


Math 103 Lineer Cebir Dersi Ara Sınavı

Math 103 Lineer Cebir Dersi Ara Sınavı Haliç Üniversitesi, Uygulamalı Matematik Bölümü Math 3 Lineer Cebir Dersi Ara Sınavı 9 Kasım 27 Hazırlayan: Yamaç Pehlivan Başlama saati: 3: Bitiş Saati: 4:5 Toplam Süre: Dakika Lütfen adınızı ve soyadınızı



ALB FOREX GÜNLÜK BÜLTEN EUR/USD GBP/USD USD/JPY USD/TRY ALTIN GÜMÜŞ Parite EUR/USD GBP/USD USD/JPY USD/TRY ALTIN GÜMÜŞ Açılış 1,2865 1,5091 95,13 1,8257 1613,29 28,91 Yüksek 1,2978 1,5185 95,13 1,8267 1614,79





Kod No. Kod No. K 0960110000 DN15 1/2 10 Ad. 19.80 D 0960210000 DN15 1/2 10 Ad. 20.36. Kod No.

Kod No. Kod No. K 0960110000 DN15 1/2 10 Ad. 19.80 D 0960210000 DN15 1/2 10 Ad. 20.36. Kod No. Thread Size Strava Beyaz 0960080100 M30x1,5 10 Ad. 12.76 rom 0960082000 M30x1,5 10 Ad. 14.76 Strava 0960110000 N15 1/2 10 Ad. 19.80 0960210000 N15 1/2 10 Ad. 20.36 Strava 0960510000 N15 1/2 10 Ad. 20.28


Kontrol Sistemleri Tasarımı

Kontrol Sistemleri Tasarımı Kotrol Sistemleri Tasarımı Frekas Yaıtı Prof. Dr. Bület E. Plati 3 Ağustos 0 Eylül 06 Taım Kararlı bir sistemi siüs girdisie sürekli rejim yaıtı Bu taımda 3 temel boyut bulumaktadır:. Kararlı bir sistem


Dış Kırılganlık Göstergelerinde Bozulma Riski

Dış Kırılganlık Göstergelerinde Bozulma Riski Dış Kırılganlık Göstergelerinde Bozulma Riski KREDİ DERECELENDİRME KURULUŞLARINA GÖRE DIŞ KIRILGANLIK Kredi Derecelendirme Kuruluşu S&P (1) Dış Likidite Rasyosu: Toplam Dış Finansman İhtiyacı/(Cari Alacaklar


MYO-ÖS 2010- Ulusal Meslek Yüksekokulları Öğrenci Sempozyumu 21-22 EKĐM 2010-DÜZCE

MYO-ÖS 2010- Ulusal Meslek Yüksekokulları Öğrenci Sempozyumu 21-22 EKĐM 2010-DÜZCE MYO-ÖS 2010- Ulusal Meslek Yüksekokulları Öğrenci Sempozyumu 21-22 EKĐM 2010-DÜZCE REHABĐLĐTASYON AMAÇLI BĐLGĐSAYAR VERĐ TABANI YARDIMIYLA BÖLGESEL ENGELLĐ KĐŞĐ HARĐTASININ OLUŞTURULMASI Yrd.Doç.Dr. Faruk


idea rsbasic KOMUTLARI

idea rsbasic KOMUTLARI idea KOMUTLARI İÇİNDEKİLER 2.1 Etiketler (Labels)... 4 2.2 Yorumlar (Comments)... 5 2.3 Semboller (Symbols)... 6 2.4 backward (geri)... 7 2.5 debug (hata ayıkla/izle)... 8 2.6 dec (azalt)... 9 2.7 do..



:ã¼ncel/altin-cocuklar-projesi-basladi-h97324.html Portal Adres ALTIN ÇOCUKLAR PROJESI BASLADI : İçeriği : Gündem Tarih : 21.11.2013 :ã¼ncel/altin-cocuklar-projesi-basladi-h97324.html 1/1 ALTIN ÇOCUKLAR PROJESI



6.HAFTA BÖLÜM 3: ÇEKİRDEK KUVVETLERİ VE ÇEKİRDEK MODELLERİ 6.HAFTA BÖLÜM 3: ÇEKİRDEK KUVVETLERİ VE ÇEKİRDEK MODELLERİ 3.1 ÇEKİRDEK KUVVETLERİ 3.1.1. GENEL KARAKTERİSTİK Çekirdek hakkında çok fazla bir şey bilmezden önce yalnızca iki farklı etkileşim kuvveti bilinmekteydi.


30.11.2014 KASA DEFTERİ



İşletim Sistemlerine Giriş

İşletim Sistemlerine Giriş İşletim Sistemlerine Giriş Süreçler ve İş Parçacıkları(Thread) İşletim Sistemlerine Giriş - Ders03 1 Süreç -Tüm modern bilgisayarlarda bir çok iş aynı anda yapılabilir. *kullanıcı programları çalışır *disk


8.Konu Vektör uzayları, Alt Uzaylar

8.Konu Vektör uzayları, Alt Uzaylar 8.Konu Vektör uzayları, Alt Uzaylar 8.1. Düzlemde vektörler Düzlemdeki her noktası ile reel sayılardan oluşan ikilisini eşleştirebiliriz. Buna P noktanın koordinatları denir. y-ekseni P x y O dan P ye


Java EE web uygulamaları geliştirmek için kullanılan açık kaynak web uygulama framework üdür.

Java EE web uygulamaları geliştirmek için kullanılan açık kaynak web uygulama framework üdür. 1 Apache Struts Java EE web uygulamaları geliştirmek için kullanılan açık kaynak web uygulama framework üdür. Kullanıcılara MVC mimarisini benimsetmek için Java Servlet API sini kullanıyor. Model-View-Controller

Detaylı Donanım yazılımı (firmware) nedir? Neden analiz edilmelidir? Analiz yöntemleri ve araçları Örnek analizler Sonuç Mesai saatlerinde Mesai saatlerinde ve boş zamanlarımda Bahçeşehir Üniversitesi Siber Güvenlik


Php Programlama Dili MySQL Uygulamaları

Php Programlama Dili MySQL Uygulamaları Php Programlama Dili İle MySQL Uygulamaları S.Çağlar Onur İşlenecek Konular? Php Nedir? MySQL Nedir? Kullanılan Yazılımlar MySQL e Bağlanmak MySQL ile İlgili Bilgi Almak Veritabanlar


Bellek Analizi ile Zararlı Yazılım Analizi

Bellek Analizi ile Zararlı Yazılım Analizi Bellek Analizi ile Zararlı Yazılım Analizi Yine bir gün hesabından duyurulan hack edilmiş ve/veya zararlı yazılım barındıran web sitelerine göz atarken gün aşırı tespit edilen,


PwC Turkey IndirectTax Services. e-defter Başvuru Kılavuzu

PwC Turkey IndirectTax Services. e-defter Başvuru Kılavuzu Turkey IndirectTax Services e-defter Başvuru Kılavuzu İçerik İçerik Bu doküman Türkiye Vergi Teknolojileri ekibi tarafından müşterilerimizin e-defter başvuru sürecinde yardımcı olması amacı ile hazırlanmıştır.


Sistem Programlama Deney 1

Sistem Programlama Deney 1 Sistem Programlama Deney 1 Deney başlamadan önce deney grubu listenizi aşağıdaki dokümana yazınız: rcwuzkqfnwhlpfdodhw/edit?usp=sharing



ASAŞ FİLTRE A.Ş. 01.01.2015 FİYAT LİSTESİ SPIN-ON FİLTRELER SPIN-ON FİLTRELER SPIN-ON FİLTRELER SP 001 12,57 TL SP 075 M 19,17 TL SP 439 9,67 TL SP 002 HT 42,94 TL SP 076 10,89 TL SP 440 H 16,90 TL SP 005 44,88 TL SP 077 8,28 TL SP 442 M 13,89



WEB PROGRAMLAMA DİLLERİNİN PERFORMANS ANALİZİ PERFORMANCE ANALYSIS OF WEB PROGRAM LANGUAGE WEB PROGRAMLAMA DİLLERİNİN PERFORMANS ANALİZİ Tuncay Yavuz Özdemir İbrahim Türkoğlu * * Elektronik ve Bilgisayar Eğitimi, Fırat Üniversitesi, Elektronik ve Bilgisayar Eğitimi, Fırat Üniversitesi, 23119,


BT İşyükü Otomasyonu Çözümleri.

BT İşyükü Otomasyonu Çözümleri. BT İşyükü Otomasyonu Çözümleri Likya Teknoloji Likya Teknoloji 2008 yılından bu yana Kurumsal ürün ve çözümler geliştirmektedir. Teknoloji Şirketi BT İşyükü otomasyonu çözümleri


JOY VAKUM-METALİZE REFLEKTÖRLÜ / WITH VACUUM-METALIZED REFLECTOR. Standard lighting used for highlighting of various objects.

JOY VAKUM-METALİZE REFLEKTÖRLÜ / WITH VACUUM-METALIZED REFLECTOR. Standard lighting used for highlighting of various objects. JOY 70 JOY VAKUM-METALİZE REFLEKTÖRLÜ / WITH VACUUM-METALIZED REFLECTOR JOY Spot aygıtlar / Spot luminaires 72 2000 lümene kadar ışık verebilen, DALI dim edilebilen ve minimum 50.000 saat ömürlü, özel



BİR TOPACIN DÖNME MİKTARI ÜZERİNE BİR İNCELEME. Adnan TEĞMEN BAÜ Fen Bil. Enst. Dergisi (005.7. BİR TOPACN DÖNME MİKTAR ÜZERİNE BİR İNCEEME Adnan TEĞMEN Ankara Üniversitesi, Fen Fakültesi, Fizik Bölümü, 0600 Tandoğan-Ankara ÖZET Serbest bir katı cismin dönme hareketinde,


Yerel Seçim Araştırması Raporu BÜYÜKŞEHİRLER

Yerel Seçim Araştırması Raporu BÜYÜKŞEHİRLER Yerel Seçim Araştırması Raporu BÜYÜKŞEHİRLER 48,1 ŞANLIURFA 22,5 8,0 6,1 3,6 11,7 AKPARTİ BDP SP CHP DİĞER KARARSIZ 25-30 Ekim 2013 tarihleri arasında 2830 kişi ile yüzyüze görüşülerek gerçekleştirilmiştir.


HSancak Nesne Tabanlı Programlama I Ders Notları

HSancak Nesne Tabanlı Programlama I Ders Notları Konsol Uygulaması Oluşturma Konsol uygulaması oluşturmak için program açıldıktan sonra Create: Project ya da New Project seçeneği tıklanabilir. New Project penceresini açmak için farklı yollar da vardır.





CİHAZ ÖZELLİKLERİ. Optima 04. Optima 14. Optima 24P. Optima F. Optima 4F. Optima 4R. Optima 34. Optima 34+ Optima SM. Optima SP. Optima HP.

CİHAZ ÖZELLİKLERİ. Optima 04. Optima 14. Optima 24P. Optima F. Optima 4F. Optima 4R. Optima 34. Optima 34+ Optima SM. Optima SP. Optima HP. Optima 04 Optima 14 Optima 24P Optima F Optima 4F Optima 4R Optima 34 Optima 34+ Optima SM Optima SP Optima HP Optima HP+ Optima Serisi Kanal içi (CIC)-Dijital programlanabilir-4 kanal-8 bant-otomatik


Zararlı Yazılım Analizi

Zararlı Yazılım Analizi Zararlı Yazılım Ha@za Analizi TÜBİTAK BİLGEM Siber Güvenlik EnsAtüsü Zararlı Yazılım Analiz Laboratuvarı TÜBİTAK BİLGEM Siber Güvenlik Ens7tüsü January 13, 2016 Eği7m İçeriği Zararlı


krlmahdrr. 28. Ozellikle EEG dlgiimlerinde tiim tetkikler yaprlabilmelidir. kanallar kullanrlabilmeli ve spektral power analiz gibi

krlmahdrr. 28. Ozellikle EEG dlgiimlerinde tiim tetkikler yaprlabilmelidir. kanallar kullanrlabilmeli ve spektral power analiz gibi krlmahdrr. 28. Ozellikle EEG dlgiimlerinde tiim tetkikler yaprlabilmelidir. kanallar kullanrlabilmeli ve spektral power analiz gibi l5-vida-rod kititlemesi tek bir setscrew,/blocker ile ile kilitleme


Uygulamalı Jeofizik İÇİNDEKİLER

Uygulamalı Jeofizik İÇİNDEKİLER Uygulamalı Jeofizik İÇİNDEKİLER BÖLÜM 1 1. GİRİŞ...1 1.1. JEOFİZİK MÜHENDİSLİĞİ... 1 1.1.1. Jeofizik Mühendisliğinin Bilim Alanları... 1 1.1.2. Jeofizik Mühendisliği Yöntemleri... 1 1.2. JEOFİZİK MÜHENDİSLİĞİNİN


Bu kitabın sahibi:...

Bu kitabın sahibi:... Bu kitabın sahibi:... Dinle bir tanem, şimdi sana, bir çocuğun öyküsünü anlatmak istiyorum... Uzun çoooooooook uzun adı olan bir çocuğun öyküsü bu! Aslında her şey onun dünyaya gelmesiyle başladı. Kucakladılar


Uluslararası Piyasalar

Uluslararası Piyasalar Uluslararası Piyasalar Market Update Piyasa Gündemi Hisse senedi piyasaları hafta ortası seansını iç açıcı olmayan bazı çeyreklik bilançolar ve piyasa ağırlığı bulunan Apple daki ileriye dönük beklentilerin


LED Aydınlatma. Parafudr Kurulumu. 3 faz bir nötr Tip 1 AC Sistem panoları için MLP. Tek Faz AC Parafudr Mimari Dış Aydınlatma İçin DS134R-230/G DS98

LED Aydınlatma. Parafudr Kurulumu. 3 faz bir nötr Tip 1 AC Sistem panoları için MLP. Tek Faz AC Parafudr Mimari Dış Aydınlatma İçin DS134R-230/G DS98 Koruma LED Aydınlatma Parafudr Kurulumu MSB6 Tek Faz AC Parafudr Mimari Dış Aydınlatma İçin Tek Faz AC parafudr sistemleri sokak aydınlatması DS134R-230/G 3 faz bir nötr Tip 1 AC Sistem panoları için DLA



1 SILVERLIGHT A G R fi 2 KONTROLLER 3 DÜZEN PANELLER ++SILVERLIGHT-icindekiler 9/12/11 4:17 PM Page vii Ç NDEK LER 1 SILVERLIGHT A G R fi 1 Girifl 1 Windows Presentation Foundation (WPF) Nedir? 2 WPF n Kazand rd klar 3 Silverlight Nedir? 4 Silverlight ile


34.Operations Research&Industrial Engıneerıng National Congress 25-27 June 2014

34.Operations Research&Industrial Engıneerıng National Congress 25-27 June 2014 BANKING SECTOR ANALYSIS OF IZMIR PROVINCE: A GRAPHICAL DATA-MINING ANALYSIS (R SOFTWARE APPLICATIONS) 34.Operations Research&Industrial Engıneerıng National Congress 25-27 June 2014 FATMA ÇINAR MBA, CAPITAL





Lisans. Ayrık Matematik Tanıtlama. Kaba Kuvvet Yöntemi. Konular. Temel Kurallar

Lisans. Ayrık Matematik Tanıtlama. Kaba Kuvvet Yöntemi. Konular. Temel Kurallar Lisans Ayrık Matematik Tanıtlama H. Turgut Uyar Ayşegül Gençata Yayımlı Emre Harmancı 001-013 You are free: to Share to copy, distribute and transmit the work to Remix to adapt the work c 001-013 T. Uyar,



GÜNLÜK ANALİZ EMTİA,ENDEKS, HİSSE,FX GÜNLÜK ANALİZ EMTİA,ENDEKS, HİSSE,FX 28.04.2014 GENEL GÖRÜNÜM ENDEKS Son % HİSSE METAL Son % S&P 500 1.863-0,81% Artan/Azalan % Altın 1.300,80 0,79% DJIA 16.361-0,85% AAPL 0,73% Gumus 19,72 0,02% Nasdaq





Doripenem: Klinik Uygulamadaki Yeri

Doripenem: Klinik Uygulamadaki Yeri Doripenem: Klinik Uygulamadaki Yeri Prof. Dr. Haluk ERAKSOY İstanbul Üniversitesi İstanbul Tıp Fakültesi İnfeksiyon Hastalıkları ve Klinik Mikrobiyoloji Anabilim Dalı Yeni Antimikrobik Sayısı Azalmaktadır


İçindekiler Jeofizikte Modellemenin Amaç ve Kapsamı Geneleştirilmiş Ters Kuram ve Jeofizikte Ters Problem Çözümleri

İçindekiler Jeofizikte Modellemenin Amaç ve Kapsamı Geneleştirilmiş Ters Kuram ve Jeofizikte Ters Problem Çözümleri İçindekiler Jeofizikte Modellemenin Amaç ve Kapsamı 1 Giriş 1 Tanımsal ve Stokastik Taklaşımlarla Problem Çözümlerinin Temel İlkeleri 2 Tanımsal Yaklaşımda Düz Problem Çözümlerinde Modelleme ilkeleri 4


ModSecurity İle Web Güvenliği Ve May 6 th, 2007 Bunyamin Demir -Turkey Chapter Lead -WeBekci Project Copyright 2007 The Foundation Permission is granted to copy, distribute and/or modify


Türkiye İnternet Sitelerinde Standartlara Uyumluluk

Türkiye İnternet Sitelerinde Standartlara Uyumluluk Ölçüm ı Türkiye İnternet Sitelerinde Standartlara Uyumluluk ve Stratejik Açılımlar 1 1 Bilgisayar Bilimleri Bölümü, İstanbul Bilgi Universitesi XI. Türkiye de İnternet Konferansı, Aralık 2006 Outline Ölçüm


2103 yılı faaliyet raporu

2103 yılı faaliyet raporu Türk Nöroşirürji Derneği Spinal ve Periferik Sinir Cerrahisi Eğitim ve Öğretim Grubu 2103 yılı faaliyet raporu Grubumuz son olarak 23.11.2013 tarihinde yapılan yönetim kurulu toplantısında üyeliğe kabul


EPDK Onaylı Depolama Tarifesi

EPDK Onaylı Depolama Tarifesi EPDK Onaylı Depolama Tarifesi TP Petrol Dağıtım A. Ş. TPPD Kırıkkale Dolum ve İşletme Şefliği Lisansın Tarih ve Sayısı Tesis Adresi : 21/02/2008 DEP/1503-2/23872 : Tüpraş Yolu Üzeri Yazı Mevkii Bahşılı-Kırıkkale


Kaynak Kod Güvenliği Bir Güvensiz API Örneği

Kaynak Kod Güvenliği Bir Güvensiz API Örneği Kaynak Kod Güvenliği Bir Güvensiz API Örneği Bedirhan Urgun, Ağustos 2010, WGT E-Dergi 6. Sayı Bu yazıda Tomcat J2EE kısmi uygulama sunucusunda bulunan bir güvenlik açığına, güvenlik probleminin kaynağına


Ağ programlama (Network programming) Altuğ B. Altıntaş 2003 Java ve Yazılım Tasarımı - Bölüm 13 1

Ağ programlama (Network programming) Altuğ B. Altıntaş 2003 Java ve Yazılım Tasarımı - Bölüm 13 1 Ağ programlama (Network programming) Altuğ B. Altıntaş 2003 Java ve Yazılım Tasarımı - Bölüm 13 1 Giriş Ağ programlama, uygulamaların ağ ortamı üzerinden iletişimde bulunarak veri alış-verişi yapılmasına


Worry-FreeTM. Business Security Standard ve Advanced Sürümler. Sistem Gereksinimleri. Administrator s Guide. Securing Your Journey to the Cloud

Worry-FreeTM. Business Security Standard ve Advanced Sürümler. Sistem Gereksinimleri. Administrator s Guide. Securing Your Journey to the Cloud Worry-FreeTM Business Security Standard ve Advanced Sürümler Securing Your Journey to the Cloud Administrator s Guide Sistem Gereksinimleri Trend Micro Incorporated, bu belgede ve burada açıklanan ürünlerde



GÜNLÜK BÜLTEN bha13 Sançmala PANL GÜNLÜK BÜLTEN 12.12.2012 İç Piyasalar 11.12.2012 Kapanış Değişim % IMKB-100 76,814 0,10 IMKB-30 95,994 0,07 USD/TL 1,7830-0,39 EUR/USD 1,3008 0,53 ALTIN 1,706-0,34 PETROL (BRENT) 107,84



MERAK MAIL SERVER ACTIVE DIRECTORY ENTEGRASYONU MERAK MAIL SERVER ACTIVE DIRECTORY ENTEGRASYONU Bir domain ortamındaki kullanıcıların aynı kullanıcı adı ve parola bilgisiyle merak mail server içerisine entegre edilmesi için domain controller ve merak


FreeBSD Nedir? Ömer Faruk Şen EnderUNIX.ORG Core Team Üyesi

FreeBSD Nedir? Ömer Faruk Şen EnderUNIX.ORG Core Team Üyesi FreeBSD Nedir? Ömer Faruk Şen EnderUNIX.ORG Core Team Üyesi FreeBSD Nedir? Berkeley Software Distribution (4.4BSD- Lite) tabanlı bir işletim sistemi Tam teşeküllü





Bu durumda bu biletler ile ilgili yapılan ödemeler gider olarak yazılabilir mi?

Bu durumda bu biletler ile ilgili yapılan ödemeler gider olarak yazılabilir mi? Çağ iletişim çağı.çağ internet çağı.internet üzerinden alışveriş gün geçtikçe artmakta.bu artışa paralel olarakta vergi boyutunda sorunlar çıkmaktadır. Özellikle işveren ve çalışanların uçak biletlerinde


DAVET YAZISI. Değerli Ka2lımcılar,

DAVET YAZISI. Değerli Ka2lımcılar, DAVET YAZISI Değerli Ka2lımcılar, Türkiye Un Sanayicileri Federasyonu üyesi Ege Un Sanayicileri Derneği (EUSD), Ege Bölgesinde ki; un sektörüne hizmet veren kuruluşları bir çag algnda toplayan, sürekli



MÜKELLEF BİLGİLENDİRME NOTU 2015-028 MÜKELLEF BİLGİLENDİRME NOTU 2015-028 Konu : E-Defter, E-Fatura Başvuru Uygulamaları hakkındadır. Tarih : 30.09.2014 Mükellef Bilgilendirme Notumuzun konusu; E-defter başvurusu sırasında nelere dikkat edilmesi


CİHAZ ÖZELLİKLERİ. Logi CIC-4. Logi ITC-4. Logi ITH-4P. Logi F. Logi 4F. Logi 4R. Logi M4. Logi M4+ Logi SM. Logi SP. Logi HP.

CİHAZ ÖZELLİKLERİ. Logi CIC-4. Logi ITC-4. Logi ITH-4P. Logi F. Logi 4F. Logi 4R. Logi M4. Logi M4+ Logi SM. Logi SP. Logi HP. Logi CIC-4 Logi ITC-4 Logi ITH-4P Logi F Logi 4F Logi 4R Logi M4 Logi M4+ Logi SM Logi SP Logi HP Logi HP+ Logi Serisi Kanal içi (CIC)-Dijital programlanabilir-4 kanal-8 bant-otomatik ses kontrol sistemi-maksimum


Uluslararası Piyasalar

Uluslararası Piyasalar Uluslararası Piyasalar Market Update Piyasa Gündemi Hisse senedi piyasaları ard arda ikinci gününü de düşüşle sonlandırmaktan kaçınsa da öğleden sonra yeni rekor seviyelere alışmış olan yatırımcılardaki





Java EE 5 Teknolojileri Jboss Seam

Java EE 5 Teknolojileri Jboss Seam Java EE 5 Teknolojileri Jboss Seam Hakan Uygun İçerik Kurumsal Uygulama Nedir? Java Teknolojileri Web Uygulaması Java EE Bileşenleri JBoss Seam Yazılım İhtiyaçları Bireysel Kullanıcı Eğitim Eğlence İletişim



ADIM ADIM METASPLOIT METERPRETER SHELL DAVRANIŞ ANALİZİ 1. GİRİŞ Bu yazıda, Metasploit exploit frameworkü üzerinde bulunan meterpreter paylodunun kullandığı bazı modüllerin özellikle ağda ve sistem üzerindeki etkileri araştırılmıştır. Bu konuda SANS'ın da yararlı



