Module developed by Yasin Tunç

Ebat: px
Şu sayfadan göstermeyi başlat:

Download "Module developed by Yasin Tunç"


1 1 June13,2011 ADEEPAPPROACH TOTURKISHSUGGESTION CARDFORSELF DIRECTEDLEARNING CARDNUMBER:5 THEME:TURKISHCUISINEANDCULTURE TÜRKMUTFAĞIVEMUTFAKKÜLTÜRÜ LEVEL:Intermediate EDUCATIVEPROJECTS: 1.ExploreTurkisheatinghabits 2.Shareandenactyourknowledgeoftypes offoodinturkey ModuledevelopedbyYasinTunç LANGUAGESTANDARDSBEINGDEVELOPED (SeeACTFLStandards): Communication(1.2):Understandand interpretwrittenandspokenlanguageona varietyoftopicsrelatedwithfood,dining andculinaryarts;(1.3)presentinformation, concepts,andideastoanaudienceof listenersorreadersonsuchtopics. Cultures(2.1):Demonstratean understandingoftherelationshipbetween culinarypracticesand perspectivesinturkishculture. Connections(3.2):Recognizethedistinctive viewpointsthatareonlyavailablethrough theturkishlanguageandculture. Comparisons(4.2):Demonstratean understandingoftheconceptofculture throughcomparisonsoftheturkishculture, Americancultureorotherindigenous cultures. Communities:Prepareadinnerand participateinaturkishnightwiththelocal community. MINDMAP MAINVIDEOSUSEDINTHE MODULE TurkishEatingHabits1&2 DriedFruits,Desserts,and Restaurant ADDITIONALVIDEOS Cheese,Foodandspices Kadayıf,Markettalk,Simit vendors,yeşilelma.

2 2 1) BAĞLAM/CONTEXT Throughthetheme TurkishCuisineand Culture youwillgetacquaintedwiththe characteristicsofdifferentcuisinetypesin TurkeyandwithTurkisheatinghabits.By watchingvideos,listeningtointerviews, searchingtheinternet,andreadingarticles, youwillacquireinsightsintotheturkish eatinghabits,differenttypesoffoods,and distinguishingculturalelementsinmodern Turkey.Whileidentifyingeatinghabitsfrom themediamaterial,youwillhavethechance tomakeacomparisonbetweenyournative cuisineandeatinghabitsandturkishcuisine andeatinghabits. MEKANVEZAMAN/SPACEANDTIME Throughthisthemeandprovidedinternet links,youwillhavethechancetolearnabout OttomanCuisineandsomeitscharacteristics andabouteatinghabitsandthetypeoffood consumedindifferentregionsinturkey. 2) TEMATİKPROJELER/THEMATICPROJECTS Twoprojectsaresuggestedforthetheme TurkishCuisineandCulture. InProject1,onesuggestedactivityistowatch thevideoturkisheatinghabits,wherethree Turkishuniversitystudentsstudyinginthe UnitedStates,talkaboutthedifferences and/orsimilaritiesbetweenturkisheating habitsandthoseofothercultures(particularly American).Itisrecommendedthatyouspot asmanyfeaturesofturkisheatinghabitsas possibleandcomparethemtothoseofyour ownnativeculture.anotherrecommended activityisthatyoureadanarticle,focusingon Turkisheatinghabits,andelicittheparticular characteristicsanddiscusstheminyour group.thereadingcanbedoneoutsidethe classroom. InProject2,onesuggestedactivityistowatch somevideosondifferenttypesoffood dessert,drinks,etc.youshouldtrytogetas muchinformationaspossiblethroughvideos andinternetsitesaboutthecharacteristicsof Turkishcuisine.Thereadingpassageusedin thepreviousprojectcouldbehelpfulhereas well,withareadingextractfromtheinternet byafamousturkishcookonthe characteristicsofturkishcuisine.then,in groups,youshouldprepareapresentationon atypeoffood,dessert,drinks,snacksand driedfruits(indigenoustoturkey).youshould presenttheoriginofthemeal,talkaboutthe regionwheretheyarepopular,whentheyare consumed,whattheingredientsare,and finallyarecipeforthem.

3 PROJECT1:TüRKLERİNYEMEALIŞKANLIKLARINIİNCELEYİNİZ EXPLORETURKISHEATINGHABITS TABLE1INSTRUCTIONALORGANIZERSandEMBEDMENTMAP IdentifyingTurkisheatinghabitsandcomparingthemwithyourown ACCESS VOICE INTERPRET ANALYZE PRESENT INTERACT READ/WATCH/LISTEN Watchandlistentoa filmedconversation betweenthreeturkish students(studyingin theunitedstates). Readthe transcriptions. Readanarticleon Turkisheatinghabits. ACTION: Organizeagroup discussion;shareyour comparisonsofeating habitsindifferent cultures. FOCUSONLANGUAGE Usediscoursemarkers /connectives(söylem ifadeleri:işte,hani, şey,yanietc.). Usequestiontag: değilmi? Useduplications:var var,dizidizi,... Passiveforms(present simple/continuous). THEME: Culturalcharacteristics ofturkisheating habits. WRITE/SPEAK/RECORD Writedownthe characteristicsof Turkisheatinghabits. Writeanoutlinefora compare contrast paragraph. Compareandcontrast Turkisheatinghabits andthoseofyourown culture. EXCHANGEANDACT Debateaboutthe distinctive characteristicsof Turkisheatinghabits. CompareTurkish eatinghabitstothose ofyournativeculture andvariousother cultures. OPERATIONS: Takenote;skimandscan; compareandcontrast;writea paragraph;usesentence connectors. ÖNERİLER/GUIDELINES A.NELERYAPACAĞIM? 1. İkiliyadaüçlügruplarşeklindevideonun izlenmesi. 2. Türkiye dekiyemekyemealışkanlıklarının videoveinternetsiteleriaracılığıyla belirlenmesi. 3. Bunlarıngruplarhalindetartışılması 4. Belirlenenözelliklerinöğrencilerinkendi kültürleriylekarşılaştırılmasıvefarklılık ve/veyabenzerliklerinbelirlenip tartışılması. 5. Türkler'dekiyemekyemealışkanlıklarına dairbelirlenenmakaleninokunup tartışmanındahaakademikbirboyut kazanması. 6. Makaledebelirleneneknoktaların tartışılması A.WHATAMIGOINGTODO? 1.Watchthevideosinpairsoringroupsof three. 2.IdentifyTurkisheatinghabitsbywatching videosanddoingresearchontheinternet. 3.Discussthehabitsyouhavediscoveredin groups. 3

4 4.Comparethehabitsyouhavefoundto yourownculture,anddiscussthe differencesand/orsimilarities. 5.ReadthearticlerelatedtoTurkisheating habitssothatthetopiccouldbediscussed inamoreacademicdiscourse; 6.Discussadditionalaspects(ifany) mentionedinthearticlerelatedtoturkish eatinghabits. B.NASILTARTIŞMALIYIM? 1. Videonunizlenmesi 2. Videodatartışılannoktalarınnotalınması 3. Gruplaraayrılaraknotlarınpaylaşılması. Bunotlardan(öğrencilerinkendi kültürleriyle)karşılaştırmanoktalarının belirlenmesi 4. İkili/üçlügruplarhalindeyerelkültürile Türkler'dekiyemekyemealışkanlıklarının karşılaştırılması. B.HOWTODEBATETHEISSUE? 1.Watchthevideo; 2.Jotdowndetailsmentionedinthevideo; 3.Getintogroupsandshareyournoteswith othergroupmembers; 4.Compare/ContrastTurkisheatinghabits withthoseofyourowninpairs,small groups,orasawholeclassdiscussion. MATERIALSforProject1: Video:TurkishEatingHabits1 2(totalof14min) This2 partvideofeaturesthreeturkishstudentsstudyingintheunitedstates,talking aboutturkisheatinghabitsandmakingcomparisonswithamericaneatinghabits.they commentonturkishcuisineandmentionsomeofitscharacteristics.theconversationis mostlyfocusedonmealcourses(i.e.,breakfastanddinner)andexpressionsthatareused beforeeatingadinnerandwhenoneisfinishedeating.commentsaremadeongivinggifts whenvisitingsomeone. See AppendixI forthetranscriptofthevideoattheendofthemodule. Text 1 :Türkler'deYemekYeme AlışkanlıklarıveBunaİlişkin DavranışKalıpları. TextonTurkisheatinghabits withenglishsummary. 1 WithpermissionofTürkKültürVakfı[TurkishCultural Foundation]retrievedfrom(seealsothewholearticle) =2. 4

5 Türkler'deYemekYemeAlışkanlıklarıveBuna İlişkinDavranışKalıpları Doç.Dr.MahmutTezcan 2 Keywords:davranışkalıpları,mutfak, zenginlik,pastırma,kebap,nitelik, etkile(n)mek,tarımsal,ekonomikyapı, hububat Canboğazdangelir UzunbirtarihselgeçmişesahipTürkler, mutfakkonusundazenginbirkültüre sahiptirler.buzenginlik,kendisinibolçeşitli yemeklerdegöstermektedir.ayrıca,tüm yiyecekveiçeceklereilişkindavranışkalıpları geliştirilmiştir. Yemekzenginliğiniifadeedenbirkaçörnek verebiliriz.örneğinsadecekaradeniz 3 bölgesindebilinenmısırkarışımıyemekler yirmiyigeçer.yinekaradenizyöresinde hamsidenyapılanyemektürlerininaşağıda belirteceğimizisimleridemutfakzenginliğimizi gösterir.hamsininiçlitavası,hamsiliekmek, hamsipilavı,hamsikayganası,tavası,köftesi, hamsiiçlitavası,hamsidiblesi,hamsi haşlaması,hamsiızgarası,hamsiböreği,hamsi buğulamasıgibi. Kayseri 4 deyirmitürlüpastırmasöz konusudur.biryazarımızşöylediyor: Yirmi türlüpastırmanınherbirininayrıözelliği,ayrı tadıvar.birkayseriliye, Sayyirmitürlü pastırmanınadını dediğimizzamansaymaya başlar. Sırt,kuşgömü,kenarmehle,eğrice, omuz,dilme,şekerpare,kürek,kapak,döş, etek,bacak,ortabez,kavrama,meme,kelle, kanlıbez,arkabas,tütünlük. (Gümüşkaynak:1966) Patlıcandanyapılanyemektürleri,salatalarve kebaptürlerimizoldukçazengindir.bıldırcın kebabı,çevirmekebabı,kuzuçevirme,çöp 2 AnkaraÜniversitesiEğitimFakültesiÖğretimÜyesi [AssociateProfessoratAnkaraUniversity]. 3 BlackSeaRegion(NorthofTurkey). 4 Kayseri:AcityincentralAnatolia. 5 kebabı,çubukkebabı,şişkebabı,derikebabı, pidelikebap,adanakebap,saçkebabı,tas kebabı,tandırkebabıbunlardansadecebirkaç örnektir. Anadoluyemekleriningenelliklebitkilerden, etlerdenvehamurdanolmaküzereüç kaynaktanoluştuğunugörmekteyiz. Türkyiyeceklerinegenelolarakbakacak olursak,aşağıdakinitelikleresahipolduğunu görürüz: Göçebelikvetarımsalekonomikyapı,Türk yemeklerinietkilemiştir. Yemeklerülkemizincoğrafibölgelerinegöre çeşitlilikgöstermektedir. Ailelerinsosyo ekonomikdüzeylerinegöre yemeklerdegenelliklebirfarklılaşmagörülür Yemekçeşitleribakımındanbaşka kültürlerdenetkilenmeveonlarıetkilemesöz konusudur. Dinselyapımızvenormlarımız,değerlerimiz mutfağımızıetkilemiştir. Beslenmealışkanlıklarındabirölçüdecinsel farklılaşmadagörülür. Tarımsalekonomikyapıdaözelliklehububatlar Türkyiyeceklerininçoğunluğunuoluşturur. Kurufasülye,yadanohut,bulgurpilavıve yanındabirsoğan,adetatürkyiyeceğinin simgesiolmuştur.özelliklekırsalkesiminen popüleryiyeceğibunlardır.anadolu yollarındakilokantalardayemekyerken garsonlarınençok Birkuru biçimindeki sesleriniduymazmıyız?askerliktenekadar çokyenirseyensin,fıkralara,şakalaşmalarane kadarkonuolursaolsun,kurufasulyeyinede vazgeçilmezbirtürkyemeğidir. AvrupaveAmerikankültürlerininaksine,daha çoksuluolarakpişirilenyemekleryenir. Sebzelerinvehububatınçoğukıymalı,kuşbaşı etli,soğanlıolaraksuilepişirilipyenir.bu nedenleçorbanınçokzenginçeşitlerinitürkler geliştirmişlerdir.kırsalkesimdekahvaltıolarak çorbanıntercihedilişibugünbilegeçerlidir.

6 6 Vocabulary(Kaynak:TürkDilKurumu,Büyük TürkçeSözlük) davranışkalıpları:tektekdavranışları açıklamayaveortakbirtanımdatoplamaya yarayanuyumludavranışlarörüntüsü. [Behaviorpatterns]. karışım:(a)birdençokşeyinkarıştırılmasıyla eldeedilenveyaortayaçıkanşey;örnek: Melezbirinsanırkınınkarışımı,buadama kuvvetvermiş. M.Ş.Esendal.[Mixture] nitelik:(a)1.birşeyinnasılolduğunubelirten, onubaşkaşeylerdenayıranözellik,vasıf, keyfiyet;2.birşeyiniyiveyakötüolma özelliği,kalite.[quality,property,attribute]. göçebelik:(a)birtoplumsalbirliğin,yaşamak içingereklikaynaklarıeldeedebilmeküzere düzenliaralıklarlayerdeğiştirmegeleneğinde veyaalışkanlığındaolması.[nomadism, migration]. etkilemek:(f)etkiyeuğratmak,tesiretmek; örnek:toplumuetkileyenolaylaraherkeskendi yorumunukatıyor. N.Cumalı.[Toaffect sb/sth]. hububat:(a)tahıl;örnek:benimmemleketim deziraataelverişlidir,hububatyetiştirir. R.H. Karay.[Cereal,grain] SUMMARY Withalonghistory,Turkshavearichcuisine, whichisevidentinthedifferenttypesoffood eateninturkey.eatinghabitswithawide varietyoffooddifferfromregiontoregion andevenfromtowntotown.nevertheless, therearemanycommoncharacteristicswith regardtoeatinghabitsinturkey.thispaper focusesonthesecommonandshared characteristics. Therearemanyexamplesreferringtothe richnessofturkishcuisine.forexample,inthe BlackSearegion,onecanseemorethan twentytypesofmealsthatcontaincornor cornproducts.therearealsomanytypesof mealsthatcontainanchovysuchasanchovy pilaf,friedanchovy, Kayseri,inCappadocia,youcanfindmore thantwentytypesofpemmican.also,kebabs, salads,andmealsmadeupofeggplantare variedandrich. ItisobviousthatAnatoliancuisineismadeup ofthreesources:plants,meat,anddough.all amatteroffact,thereisaconnection betweentypesoffoodandcivilizationofa culture.thecharacteristicsofthecuisineofa countrygivecluesaboutitscivilization. Turkishfoodtypeshavevariedfrom civilizationtocivilization,whichhasshaped thelandandimpactedcurrenteatinghabitsof Turkishpeople. Wecanobservethefollowingcharacteristics whenwelookatfoodsconsumedinturkey: Nomadismandagriculturaleconomic structurehaveaffectedturkishfoods. Foodsvaryintermsofgeographical regions. Thesocio economiclevelsofpeoplehave aneffectontheirfood. Turkishcuisinehasinfluencedandhas beeninfluencedbyotherculturesinterms ofthevarietyoffoods. Thereligiousstructureandnormsof Turkishsocietyhaveinfluencedthe cuisine. Thereisacertainextentofgender differenceaswellintermsofeating habits.

7 7 Cereals,especially,accountformostof Turkishmeals.Drybeans,chickpea,and bulgurpilafwithanonionhavebeenasymbol ofturkishcuisine.thesearethemostpopular foodsoftheruralareas. UnlikeEuropeanandAmericancultures,in Turkeypeoplemostlyeathome cooked meals.mostofthevegetablesandcerealsare cookedinwaterwithmincedmeat,steak (kuşbaşıet)andonion.turkshavecomeup withmanytypesofsoupsuchastarhana a traditionalturkishcerealfoodconsistingof flour,yogurt,andvegetablesfermentedthen dried gruel(unçorbası),lentilsoup,soup withyogurt,andricesoup. PROJECT2: TÜRKMUTFAĞINADAİRBİLGİLERİPAYLAŞINVEUYGULAYIN SHAREANDENACTYOURKNOWLEDGEOFTYPESOFFOODINTURKEY TABLE2INSTRUCTIONALORGANIZERSandEMBEDMENTMAP Presentingorpreparingatypeoffood/drink/dessert ACCESS VOICE INTERPRET ANALYZE PRESENT INTERACT READ/WATCH/LISTEN Watchandlistento videosaboutthe differenttypesoffood. Skimthroughthe differentinternetsites providedandtake notesonrecipesand thecharacteristicsof variousmeals. FOCUSONLANGUAGE Passive(present simple). Presentformoftobe Dir (DIr) Passive(present simple/continuous) WRITE/SPEAK/RECORD Writearecipeforat leasttwotypesoffood indigenoustoturkey, tryitoutathome,and thensharetheproduct withyourfriends. EXCHANGEANDACT Discusswhatkindsof food,drinks,and dessertareconsumed inturkey. Presentthe characteristicsof differenttypesoffood inturkey. ACTION: CookfortheTurkish Night;present differenttypesoffood inturkey. THEME: Turkishcuisine. OPERATIONS: Internetsearch;writerecipes;use descriptivediscourse.

8 ÖNERİLER/GUIDELINES A.NELERYAPACAĞIM? 1. Videonun(vesağlananalternatif videoların)izlenmesi. 2. Türkiye detüketilenfarklıyiyecekleredair notlaralınması. 3. Buyiyecektürleriningruplandırılması (yemekler,tatlılar,kuruyemişler, içecekler). 4. Sunumgruplarınınbelirlenmesivesunum konusunun(içeriğinin)belirlenmesi. B.NASILSUNMALIYIM? 1. Öncelikleeldeedilenbilgileringözden geçirilmesi. 2. Gruplarınbelirlenmesi. 3. Hergrubunbelirlenenyiyecek gruplarından(yemekler,tatlılar,kuru yemişler,içecekler)sunumiçinbirertür belirlemesi. 4. Sunulacakyiyecekveiçecektürleri hakkındaderinbilgitoplanması(resim, video,makale,vs.). 5. Bilgilerinorganizeedilmesivesunulması 6. Sunumlaberabersınıftakidiğerbireylere sunulanyemeklerintariflerinin hazırlanması. MATERIALSforProject2 VideoDriedFruits,DessertsandRestaurant(7 min)withthreeinterviews.thefirstinterview isaboutapricotsanddriedfruits,thesecond oneisaboutbaklavaanddessert,andthe thirdoneisaboutdifferentdishtypesfoundin arestaurant(lokanta).see AppendixII for A.WHATAMIGOINGTODO? 1.Watchthevideoandotheralternative videos(iftimepermits). 2.Takenotesonthedifferenttypesoffood consumedinturkey. 3.Categorizethefoodunderheadings,such asfood,desserts,driedfood,anddrinks. 4.Determinethepresentationgroupand topic. B.HOWSHOULDIPRESENT? 1.Revisethenotesyouhavetaken. 2.Determineyourgroup. 3.Determinethetypeoffood,driedfood, dessert,anddrinksthatyouaregoingto present(asagroup). 4.Dodeeperresearchonthethingsthatyou aregoingtopresent. 5.Organizetheinformationyouhave collected,andpresentit. 6.Preparearecipeforthefoodyouaregoing topresenttotheclass. thetranscriptofthevideoattheendofthe module. TextTÜRKMUTFAĞININÖZELLİKLERİ expressescharacteristicsofturkishcuisine. 8

9 TÜRKMUTFAĞININÖZELLİKLERİ 5 Yazan:AYDINYILMAZ 6 TürkMutfağınınÖzellikleri AydınYılmaz Keywords:hamurişi,çeşit/tür,haşlamak, kavurmak,baharat,zeytinyağlı,tatlı,çorba. PassiveStructures TürkMutfağındayemeklerinekmekleyenmesi esastır. Hamurişlerivepilavlarönemlidir. Kebaplarınyanısıraetyemeklerininçeşitleride boldur. Sebzelerhaşlanmışolarakdeğil,et,soğan, domatesveyasalçalıpişirilirler. Çoğunluklayemeklerekonansoğan,kıyma,et, salçasukonmadanönceyağdakavrulur. Soğanvebazıyemeklerdedesarmısak yemeğinanamalzemesidir. Çokçeşitlisebzekullanılırveaynısebzeden çoksayıdayemektürüyapılır.tencereyemeği hakimdir. Yakınzamanakadarkullanılantereyağı,içve kuyrukyağlarıkullanımınıazaltmaktadır. Soğukyemeklerinanamalzemesi zeytinyağlıdır.zeytinyağınınpilav,salatave kızartmalardagenişkullanımyerivardır. BulgurenazpirinçkadarTürkMutfağına hakimdir(köfte,çorba,salatav.s.). Kurumeyveler,hoşafvekompostoyapımında kullanıldığıgibi,bazıyörelerdeyemeklerdede kullanılmaktadır. Baharat,çeşitvemiktarolarakyemeklerdeaz kullanılır.ençokkullanılankarabiber,kırmızı biber,tarçın,kimyon,yenibahar,nane,kekik, fesleğen,çörekotu,susamgibibaharatlardır. Maydanoz,dereotu,naneTürkyemeklerinde genişölçüdekullanılır. Yoğurtyemekmalzemesigibikullanılır. Tabaksüslemeveboyamasanatıyeniyeni gelişmektedir. Yemeklerpişirilirkentuzukonur. Tatlıçeşitleriçokfazladır.Hamurvesütlü tatlılarhakimdir.ayrıcahelvaçeşitleri yaygındır. Yemeklerarasındaşıra,şerbet,ayranveturşu sularıiçilir. TürkMutfağındakoyunetihakimdir.Dana, tavukvebalıketikullanımıartmaktadır. Türkmezetabağındazeytinyağlılar,börekler, peynirlerveçiğyenebilensebzelerhakimdir. Türketlerikesimfarkındandolayıdahaaz kalındırvebulezzetfarkıyaratmaktadır. TürkMutfağındadonmuşetvesebze kullanılmaz.konservesebzelerfazla benimsenmemiştir. Türkyemeklerininçoğuiçinözelkap kacağa ihtiyaçvardır. Çorbamönünündemirbaşıdır. Türkyemeğindeçeşitlerinsunuluşsırası farklıdır. Evmutfağıileticarimutfakarasındaçeşit yönündenfarklılıklarvardır. 5 Source:, retrievedfromthissiteon9/17/ AfamouscookinTurkey. 9

10 10 Vocabulary(Kaynak:TürkDilKurumu,Büyük TürkçeSözlük) hamurişi:hamurdanyapılanyiyeceklerin geneladı.[pastry]. yanısıra:yanında,birlikte.[inaddition]. hakimolmak:(f)1.buyruğunuyürütmek, egemenliğinisürdürmek;örnek:birmilletin ruhuzaptolunmadıkça,birmilletinazimve iradesikırılmadıkçaomilletehâkimolmanın imkânıyoktur. Atatürk.2.Etkiliolmak, hükmetmek.[todominate]. haşlamak:(f)sudakaynatarakpişirmek; örnek:ninem,yoldayerimdiyeikiyumurta haşladıydı. H.E.Adıvar.[Toboil]. donmak:(f)1.sıvı,soğuğunetkisiylekatı durumagelmek,buztutmak.2.yaşamını yitirmek,soğuktanölmek;örnek:donmak üzereolaninsanlarıntatlılığınıiçimde duymayabaşladım. S.F.Abasıyanık.3.Çok üşümek.[freeze]. benimsemek:(f)1.birşeyikendinemaletmek, sahipçıkmak,kabullenmek,tesahupetmek. [Toadopt,embrace,andinternalize]. demirbaş:(a)1.biryerdekullanılan,biryere kayıtlıolan,birgörevlidenöbürüneteslim edilendayanıklıeşya;örnek:salonun demirbaşıolanpiyano,yağmurlugünlerde çocuklarıneğlenmesiiçinkullanıldı. A.Kutlu. [permanentorheavyfixturesorequipment]. ALTERNATIVEVIDEOS Avideooncheese:Thespeakertalksaboutatypeofcheeseindigenoustosomelocalareasin Turkey.Hetalksabouthowthatspecifictypeofcheeseismadeandhowitispreserved. Foodandspices:ThespeakertalksaboutdifferenttypesofspicesusedinTurkey. Kadayıf:Thespeakertalksabouthowatypeofpastry(dessert) kadayıf ismade. Markettalk:ThisvideocouldbeusefulforTurkishlearnerswhoarenotfamiliarwith bazaar/market/farmers'markettalk. Simitvendors(time1.36totheend):Thisvideo couldbeusefultodiscusstheroleofsimitin manypeople'slives.itcouldbeusedtodiscuss thesocio economicstructuresinturkey, especiallyinbigcities. Yeşilelma:Thisvideohighlightsthedynamicsof food,culture,andfamilyrelationsinturkish culture.itisacookingprogramshownona Bayramday.Therefore,therearemanylocal elementsanddialoguesonbayram. 3) İNTERNETBAĞLANTILARI/INTERNETINTERNETLINKS Bütünilleringenelmutfaközellikleri:Thissitepresentsdifferenttypesoffoodindigenousto eachcityinturkey. yresel yemekleri lezzet haritasi hangisehir hangi yemekle meshur/ Trakyayöresi:Tekirdağmutfağı:Thissiteprovidesinformationonthefoodindigenoustothe ThracianregioninTurkey. BatıTrakyamutfağı(özellikleri):Thissiteprovidesinformationonthefoodindigenousto ThracianregioninTurkey Türkler'deYemekYemeAlışkanlıklarıveBunaİlişkinDavranışKalıpları:Hereyoucanfindarticles

11 onturkisheatinghabitsandsomerecipesforpopularturkish meals ThisisaveryhelpfulsitewhichincludesashorthistoryofTurkishfood,thepopularfoodin Turkey,thenamesofthefoodsandtheirEnglishtranslations: Youcanfindvarioustypesofrecipeatthesesites: ThisisabeautifulsitethatincludesavideocliponTurkishcuisine: 5c8 Inthisvideo,theownerofoneofthemostfamousbaklavarestaurantsinGazianteptalksabout howtomakequalitybaklava: 4) DEĞERLENDİRME/EVALUATION Youwereableto: Needs improvement 11 Toacertain extent Good Takedetailednotesonthetheme TurkishCuisineandCulture while watchingthevideos Skimandscanarticle(s)forrelevant information. Categorizenotesunderspecified topics. Discussyourideasthroughsemistructuredcontext/discourse. Usepersuasivelanguageby combininglanguageelementsin discretesentencesandstringsof sentences Createanumberofbasic, uncomplicatedcommunicative exchanges Connectyoursentencesandideas intoparagraphsoressays,using cohesiveelements Paraphrasetheideasinthe reading/audiotext Collectdatafromavarietyofsources andcombinethemintoameaningful unit Presentyourideasinawaythatis easilyunderstoodbyanative audience Presentinformationinalogical Toagreat extent

12 sequencethataudiencescanfollow Presentinformationusing appropriate,standardgrammar Includetransitionstoconnectkey pointsinpresentingyourideas. DEĞERLENDİRME Yapabiliyorum: TürkmutfağıveKültürütemasınadair videolarıizlerkendetaylınotlar alabiliyorum. İlgilimakaleleritarayıpgözden geçirebiliyorum. Belirlikonulardanotlarımı gruplayabiliyorum. Yarıyapılandırılmışbağlamda fikirlerimitartışabiliyorum. Kısmiyadaparçacıklıcümleler halindeiknaedicibirdil kullanabiliyorum. Türkçe'debirkaçbasitveçok karmaşıkolmayankalıplarkullanarak iletişimkurabiliyorum. Çeşitlibağlaçlarkullanarakfikirve cümlelerimiparagrafyadametne dönüştürebiliyorum. Okumayadadinlememetinlerinde geçenfikirlerikendicümlelerimle yenidenkurabiliyorum. Farklıkaynaklardanveritoplayıpbu verilerianlamlıbirbütüne dönüştürebiliyorum. Fikirlerimi,Türkçe'yianadiliolarak kullananinsanlarınanlayabileceği şekildedilegetirebiliyorum. Dinleyicilerintakipedebileceğişekilde bilgiyisunabiliyorum. Standartdilbilgisikurallarını kullanarakbilgiyisunabiliyorum. Anafikirlerimianlatırkenbağlaçlar kullanabiliyorum. Geliştirilmeli Kısmen yapabiliyorum. İyiyim Oldukça iyiyim 12

13 13 5) YARDIMCITEMALAR/FOLLOW UP Youcouldexpandthe TurkishCuisineandCulture themebyreferringtotheottomancuisine, sothatahistoricalperspectivecouldbegainedandintegratedintomodernturkishcuisine.the historyofmodernturkishcuisinecouldbetiedtoottomancuisineandtheothercuisinesthat haveaffectedturkishcuisine.thiswaytheideaofdiversitycouldbeintegratedintoaseemingly modesttheme TurkishCuisineandCulture. TurkishCuisineandCulture couldalsobeextendedbyanalyzingthesocio economicfactorsin differentregionsthataffectedtheireatinghabits.therelationshipbetweenpeoples eating habitsandtheirphenomenological/anthropologicalexistencecouldbeanalyzed.also,theeffect ofgeographicalconditionsonpeoples eatinghabitsandthetypesofthefoodtheyeatcouldbe analyzed.youcouldevenprovideyourownlocalexamples. Moreover, TurkishCuisineandCulture couldbefurtheredbyreferringtothetraditionaldays andcelebrationsandthetypeoffoodthatisconsumedonthosedays.moreculturalelements couldbeintegratedintothetheme.seetheyeşilelmamovieandthepptpresentationnoii (Foodforspecialdays)orthispurpose. Finally, TurkishCuisineandCulture couldbefurtheredbytakingthecharacteristicsofseven differentregionsintoconsiderationandtalkingaboutthedifferencesand/orsimilaritiesamong theseregionswithregardtotheireatinghabitsandthetypeoffoodtheyconsume. 6) MÜZİK/MUSIC Youcanusethefollowingtypesofmusicwiththereedflute[neyinTurkish]andthelute[udin Turkish]orsomeselectionsfromclassicalTurkishmusicandTurkishfolkmusic ) KAYNAKÇA/BIBLIOGRAPHY Özbek,N.(1995).DiscourseMarkersinTurkishandEnglish:Acomparativestudy.Unpublished Ph.D.Thesis.UniversityofNottingham,UK.RetrievedOctober01,2009,from Tezcan,M.(2000).TürkYemekAntropolojisiYazıları.Ankara:KültürBakanlığıHAGEMYayınları. RetrievedSeptember17,2000,from Internetsites 1. 2. 3.http://e

14 8) SUNUMLAR/POWERPOINTPRESENTATIONS PresentationI:InthevideoTurkishEatingHabits,thespeakers,whiletalkingabouteating habitsinturkishculture,goontotalkaboutthetypesofdrinksanddessertthatareindigenous toandpopularinturkey.inordertosupportthecontentoftheconversation,thepowerpoint presentationalcoholicandnon alcoholicdrinksinturkeyintroducesthepopulartypesof drinksthatareconsumedinturkey,mostofwhicharelocal.youcanwatchthepowerpoint afterviewingthevideointhefirstprojectorbeforethesecondprojecttogetanideaofeach drink,whicharepartofyourpresentationsforthesecondproject. PresentationII:Foodforspecialdaysisaboutthetypeoffoodconsumedonspecialoccasions. TherearemanyspecialdayscelebratedinTurkey,andpeoplehavedifferenttypeoffoodon mostofthesedays.thepowerpointpresentationintroducesthespecialdayandtypeoffood attributedtothatday.youcanmakeuseofthispowerpointasacontingencyplaniftime allocatedforproject2(presentationofdifferentturkishfood,drinks,anddesserts)isenough. Thisis,indeed,oneofthethemestofurthertheproject. 9) YARDIMCIKONUŞMAKALIPLARI/PRE ORALACTIVITY Pleaseusethefollowingstructurestofacilitatethediscussion. Presentations Türkkültüründe,yemekyemealışkanlıklarıbağlamındafarkettiğimözelliklerdenbir tanesi Diğerbelirginbirözelliğişuolabilir... Dikkatçekicinoktalardanbirtanesi,kanaatimce,şudur... Bizimkültürde(konuşmacınınkendikültürü),Türkkültüründenfarklıolarakşunlar yapılır... Bizimkültürde(konuşmacınınkendikültürü)bukonuşöyleyken(açıkla),Türkkültüründe bukonuyaşöylebakılmakta... BizimkültürdeAkonusunaşuaçıdanbakılır,ama/fakatTürkkültüründebukonu şöyledir... İkikültüründe(konuşmacınınkendikültürüveTürkkültürü)ortaközelliklerişunlar olabilir... Farklılıklarolsada,ikikültürdeA/B/Cnoktalarıbağlamındabirbirinebenzemekte... Yiyecek/içecek/tatlı/kuruyemiş.Bukonularanlatılırken(sunumesnasında)dikkatedilmesi gerekennoktalarşunlardır: bütüntürlerinhangibölgeyeyadaşehireaitolduğununbelirtilmesi; genelliklenasılvenezamantüketildiğinedairbilgiverilmesi; yiyecekveiçeceklerinmalzemelerininnelerolduğununanlatılması; varsayiyecekveiçeceklerinhangimutfaktantürkmutfağınageçtiğininbelirlenmesi; bütüntürlereaitresimler,vevarsahazırlanışşekillerinedairvideolarınsağlanması; mümkünsetürlerinbölgeninyadaşehrinsosyo ekonomikyapısı/seviyesiyle bağlantısınınaçıklanması. 14

15 EK/APPENDIXI VideoTranscriptofthemovie TurkishEatingHabits Keywords:kültür,alışkanlık,farklılık,kahvaltı,öğün,ekmek(a),çeşit,sıra,rakı,tatminetmek, misafir,tabak,israf,(misafir)ağırlamak. Conversationmarkers/connectivesandduplications Yasin:Esracığımelinesağlıkçokgüzelolmuş. Esra:Afiyetolsun. Ayşegül:Gerçektennefisolmuş. Esra:Cevizlitarçınlıyaptımsiziniçin. Yasin:Öylemi,teşekkürederiz,zahmetolmuş(bak). Ayşegül:Kokusu,rengi,herşeymükemmelolmuş. Yasin:BirankendimiziTürkiye dehissettikböyleçay vallaözlemişiz Yasin:Geçen(lerde)düşünüyordumda,böyle(hani)Amerikankültürüyle,Türkkültürü arasındaki,yemekyemealışkanlıklarıbağlamındafarklılıklarnelerolabiliryadavarmı? Esra:Varvar,meselagünebaşlarkenbizimiçinkahvaltıçokönemlidir.Kahvaltısızadımımızı dışarıatamayız.hanibazıları"kafamçalışmıyor"derhatta."çayıiçmedenkafamçalışmaz"der bazıları.başka kahvaltıdapeynirimizolur,zeytinimizolur;reçellerolurgeneldeevyapımı:çilek, (Yasin:evet)Vişne kayısı(ayşegül:güzelkokulu),şeftali,değişik,değişik. Ayşegül:Kahvaltıanaöğündüraslındabizde.Geçiştirilmemesigerekirkesinlikle. Esra:Amerika dakibrunchgibidahaçokzaten,değilmi? Yasin:Evet,çeşitlikahvaltıadlarıolsada,bizimkigibibirşeydeğil,öğünleşmemiş.Bizdeenaz akşamyemeğikadarönemlidir(aslında)kahvaltı. Ayşegül:Kesinlikle Esra:Hattakahvaltıiçinrestoranlarvardır. Yasin:Tabii,özellikle(şeyde)Van 7 daçokyaygındıro.kahvaltırestoranlarıvardır,hattainsanlar İstanbul dangiderordakahvaltıyapmaya. Esra:Bolu da 8 davarbirtane(yasin:boludağı'ndavar) Ayşegül:Kahvaltısaraylarıçokgüzeldir,(marketler);gidersin,böylebütünürünlerdizidizi.Çeşit çeşitzeytinler,beyazpeynirler,reçeller,sadecekahvaltımamülleri.başkahiçbirşeyyok,(yasin: kesinlikle)çokgüzel. Yasin:Sıcakekmekleberaber Ayşegül:Oooo,sıcakekmekdedin Esra:Fırınlardan,değilmi? Yasin:Evet Esra:Sıcaksıcak Yasin:Haniekmekokadaryaygınkibizdezatenhersokaktamutlakabirfırıngörürsünböyle; sıcakekmekyapanfırınlarvardır. Esra:Sabahleyinevinküçüklerigönderilir Yasin:Veinsanlarsırayageçer Esra: Niyehepbengidiyorum,birkeredeağabeyim(abim)gitsin. Ayşegül:"Yok,senküçüksün,seningitmenlazım." Yasin:Evet 7 AcityintheeastofTurkey. 8 AcityinthewestofTurkey. 15

16 Ayşegül:Birdeekmekçeşitleri,yanionlarıngörüntüleriböyle,başlıbaşınasanataslında.Çiçek ekmekler,somunekmekler,susamlı,haşhaşlı,(esra:kepekli)kepekli,pideler 9 Yasin:Evetonuözlüyorumben Ayşegül:Bende(çok),ogörüntüyü Yasin:Fırınkültürü,değilmi?Türkiye dede(böyle)büyükkentlerdebirazazalmayabaşladı,ama küçükkentlerde,kırsallarda,halaoşeyvar,ofırınkültürüvar.insanlarhattaşeyyaparböyle, yemekiçihazırlayıpfırınaverirler,(mesela). Ayşegül:Pide Yasin:Odavardır,evetpideyapmakiçin Esra:Fırındahadeğişikolduğuiçin (Yasin:kesinlikle) Ayşegül:Otadıevdeyapılanıntadınıasla (Yasin:vermiyor) vermiyor Yasin:Başkanelerolabilir? Ayşegül:(Yemek)Öğünlerdekiyemekyemesıramız,yanihepçorbaylabaşlamamız;kahvaltı dışındadiğeröğünlerde.(esra)çorbaylabaşlıyoruz. Yasin:Değilmi?özellikleakşamyemeklerindeçorbaylabaşlarız,arkasından(işte)anayemekler gelir,yanındasebze,yadasebzeyemeğivardır. Esra:zeytinyağlıolursebzeliler Yasin:Kesinlikle Onundışında Esra:Salatabulunurmutlaka. Yasin:Mezelervardırzatenyanında (Ayşegül:evet) Yasin:İçkikültürüpekyaygındeğil Esra:Şarapkültürüdeğil Belkiokadar,yaniFransa dakikadarbelkiyaygınolmayabiliramarakı, rakımızvardır. Yasin:Evet,özellikleböylesahilbölgelerde rakısofraları 10 davardır. Ayşegül:Rakı,beyazpeynir,kavunüçlüsü(Yasin:kesinlikle).Değilmi? Ayşegül:Birdeyemekhiçbitmezbizde.Yaniakşamyemeğiniyersin Esra:Misafirlergeldiğindeözellikle. Ayşegül:Özelliklemisafirgeldiğinde. Esra:yemektensonrabirkahveyapılır,Türkkahvesi.Ondansonra,kahvedensonrabirçay.Çayın yanındaböyle,iştetatlı,atıştırmalıkçerez.(ayşegül:kuruyemişler).ensonundameyvegetirilir. Ayşegül:Misafirkesinlikletatminedilmelidir. Yasin:Tabi,evet,misafiriboşgönderemezsinbizde. Ayşegül:Yoksaiyiağırlanmamışolurmisafir. Yasin:Aynen.Oyüzdendikkatliolmakgerekiyor.Dahadoğrusudışarıdangelenlerinbukonuda dikkatliolmasıgerekiyor. Esra:Kesinlikleaçkarnagelmelerilazım Yasin:Oobirkural,obirkural. Ayşegül:Pekhayırdemeşanslarıyokgaliba(misafirlerin).Çünkübizbirazısrarederiz. "Yemelisin Tabağınıbitirmelisin " Yasin:Evet,oçokçokönemlikesinlikle. Esra:"Şundandaal.""Bunubeğenmedinmi?" Ayşegül:Evet,eğerazyerlersebeğenmediolurlar Esra:Değilmi? Esra:Tabaktayemekbırakılmazmesela.(Yasin:evet)Bizdebirazgariptir. 9 CommonbreadtypesconsumedinTurkey. 10 Rakı:atraditionalTurkishdrink,whichisgenerallyconsumedwithmashedeggplant,aspreadmadeofyogurt seasonedwithgarlic,calamari,shrimp,fish,melon,cheese,etc. 16

17 Yasin:Hani şeyvardır israftırobırakmak(tabaktayemekbırakmak) Ayşegül:"Çöpegidecektir"diyedüşünülürveyani Yasin:Başkakültürde(dahadoğrusu)çokfazlafarketmedimbenonu,hanitabağıbitirme, tabağıboşbırakmama.birnevievsahibinesaygıyıdagösteriyor.işte"yemeğiniçoksevdim." Ayşegül:Mesela,şuanyediğimizöğününasıladlandırabiliriz?İkindiçayıderizherhalde. Esra:Öğündeğildeikindiçayıevet.Çay,yanındaböylekek,salata,kısırmesela. Yasin:Değilmi?Evet. Esra:Benyapmadımama maalesef. Ayşegül:Olsun,budagayetyeterli. Esra:Birdahakisefereyaparım. Yasin:Yemeksaatlerininasılbuluyorsunuzburada?Geneldedahastrict(katı)gibigeldi,daha oturmuş. Esra:Burada,evet,bellisaatlerdebelliöğünleryeniyor.Bizherhaldebukadar,dakikmidiyeyim, dakikdeğilizyemekkonusunda. Yasin:Dahaesnek,bizimkültürde. Ayşegül:Bizimiçinöğleyemeğisaationikiyle(12),bir(1)arasıylakısıtlıdeğilaslında.Yanion ikidenbelkidördekadarbizimiçinöğleyemeğiyenilebilir. Yasin:Kesinlikle,buradaobirazdahaşeygibigeldi. Ayşegül:Aynışeyakşamyemeğiiçindegeçerlideğilmi,Yasin?Yanialtıda,yedidebaşlasa,gece onda Esra:Dokuzakadaryemekyeniyordışarıda.(Yasin:Kesinlikle). Ayşegül:Yaon,onbir,oniki.İstanbul daonikidebilesıcakyemekbulabilirsinyani. Esra:Onunadınıbirazakşamyemeğikoymakzoramayinedeenazındanlokantalaraçıktır. Ayşegül:Menüyübulabilirsin,aynımenüyü. Yasin:Yemeklerdensonra,özelliklemisafirağırlamalarda,tatlıvardır.Kaçamazsın.Yemekten sonra,belkimeyvedenönceyadasonramutlakatatlıyenir. Esra:İçecekolarakdageneldeayran 11 çokyaygın Yasin:Evet,dahadoğrusubaşkayerdeolmayanayranyaygındırbizde. Esra:AmerikalıbirarkadaşımTürkiye yegitmişti;ayranıiçemedi;çokdeğişikgeldi. Ayşegül:Gerçektenmi?(Yasin:ciddimisin)? Esra:"Nasıliçiyorsunuzsizbunu?"dedi. Ayşegül:BenimdebirAmerikalıarkadaşımayemekhazırlamıştımbenbizimevimizde.Onun şöylebirtepkisiolmuştu ıspanakyemeğiyapmıştım,üzerineyoğurtsosu,sarımsaklı yabu yoğurtbununüzerinde,yoğurttatlıbirşeydeğilmi,meyveliyoğurtolaraktüketilmeli,amabu sebzeyemeğibununüstündeneişivar? İlkçatalıalırkençoktereddütetti. Esra:Bizyoğurdusadeyiyoruzya Buradageneldemeyveli Ayşegül:Tatlıolarak. Yasin:Bizdenİngilizce'yegecenkelimelerdenbirtanesiyoğurt,değilmi? Esra:salep 12 var;birdeboza 13 var.bunlardatürkiye deyaygınolaniçecekleramaburada bulmakbirazzor. Yasin:Evet,evet.Helesalebiçokzor Bozavesalepbizimsokaklardadasatılır,gecesesleri duyarsınız. 11 Adrinkmadeofyogurtandwater. 12 Ahotdrinkmadewithpowderedsalep,thedriedtubersofcertainorchids(Redhouseİngilizce TürkçeSözlük). 13 Thick,slightlyfermentedmilletdrink. 17

18 Esra:Onlardakışiçeceğibiraz. Yasin:Kesinlikle Muhteşemoluyor. Ayşegül:Birdeözelgünleriniçeceğidirsalepaynızamanda.Meselalisemezuniyetiiçineski arkadaşlar,eskilisemezunlarıtoplanırlar,birarayagelirler,salepgünüyaparlaristanbul da. Annemlerinsalepgünlerivardırhala.Lisedenarkadaşlarıylatoplanırlar.Pilavgünügibibirşey. Esra:Pilavgünlerivar(evetpilavgünleri) Yasin:"Gün"kavramıvar,özelliklekadınlardayaygın,erkeklerpekkatılmaz. Esra:Altıngünleri 14 var. Yasin:Neleryapılıyorgeneldeogünlerde? Esra:Altıngünlerindemantıkşu:annemdenbiliyorum,benhiçkatılmadımama. Ayşegül:Bendeaynışekilde Esra:Birazdaha(böyle)eskidenyaygınmış,şimdiyapılıyormubilmiyorum.Şimdibelkidolar günleriyapılıyordur. Ayşegül:Çokdoğrusöylüyorsun,trendeuygun. Esra:Obirazşeyböyle,evsahibineparatoplamakgibibirşey(evsahibiiçin).Evinegidilenkişiye herkesbellibirmiktarparagötürüyor.meselabiraltınakararveriyorlar,herkesbiraltın götürüyor.bubirseneboyuncabütünogünekatılanlarınevindetoplanıyor. Ayşegül:Herhaftayadaheraybirininevinegidiliyor. Esra:Meselayemekler,yemekderkenböyleatıştırmalıkkek,börek,poğaça,(kısır),salatalar çaylaservisedilir.muhabbetedilir. Yasin:Evet,birsosyalfaaliyettiraslında. Esra:Sosyalfaaliyet,evet.Yardımlaşmagibibirşey.Meselaondaşeydenbaşlanır,ençokkimin ihtiyacıvarsaondanbaşlanır. Ayşegül:Yadabazenşeyyapılır,aslındabirsıravardır,altınlarıntoplanmasırası.Amameselao aybirinindahaçokihtiyacıvardır,bilinirveosıradeğiştirilir,"bensıramısanaveriyorum"denilir mesela.çokgüzelbirdayanışmaörneğidir. Yasin:Kesinlikle Yemeklerdenönceyemeklerdensonrabizimçeşitlidilselfarklılıklarımızdavar, değilmi?yemeğebaşlarkenmeselabesmele 15 çekilmesi. Esra:Evetbesmeleylebaşlanır. Esra:Birazdahatraditional,yani (Yasin:dahageleneksel)dahagelenekselbirşey Esra:Yemeğinbereketlenmesiiçinbesmeleylebaşlanır. Yasin:Kesinlikle.Dolayısıylayemekbirnevikutsaldırbizde.Yada(hani)ekmekmeselaçok kutsaldır.yeredüştüğünde(esra:kırıntılarfalan )alırsın(ayşegül:üzerinebasılmamalıdır). Ayşegül:Birdeyeredüştüğündeöpersinoekmeği,öpüpalnınakoyarsın. Esra:İşteobirsaygıgöstergesiolarakherhalde (Ayşegül:Kesinliklekutsal) Yasin:Dolayısıylabesmeleylebaşlarız.(Esra:(Ekmektenbahsetmeyedevameder)Çöpeatılmaz meselakuşlaraveyahayvanlaraverilir. Yasin:Sonra.Yemektensonranetürşeylerkullanırız,ifadelerdebulunuruz? Ayşegül:"Ellerinesağlık,"(elinesağlık),"afiyetolsun."(Yasin:"Ziyadeolsun"),"çokgüzelolmuş," "kesenizebereket." 16 Yasin:Evet. Esra:Yemeğiyapankişiyevemeselamisafirlikteysenevsahibine,böylegüzeldileklerde bulunulur.(ayşegül:iltifat)iltifatlardabulunulur. 14 Specialsocialgatherings(mostlycommonamongwomen),atypeofasocialactivitylikeapotluck. 15 Theholywordsthataregenerallyutteredwhenstartinganactivity(inIslamiccultures). 16 Expressionsthatarecommonlyusedwhenexpressingyourgratitudetosomeone(e.g.,thehostwhomadethe dinner). 18

19 19 Ayşegül:Yemeğibeğendiğini,yemektenhoşlandığınıgöstermekiçinmemnuniyetinbirifadesi olarak. Yasin:Böyleözeldavetiyeleregiderkenbizdehediyegötürmekültürünasıldır?Yadafarklıolarak [bizneyaparız?]. Ayşegül:Benimailemde,dahaçokyakınakrabalarbirbirleriniziyaretederken,özelbirgünise eğer,dahaçokmeyvegötürürler,tatlıgötürürler(yasin:baklava),baklava,birpaketbaklava. Eğerhastaysaoziyaretedeceğininsanakolonya,(Yasin:Lokum)lokumolur(Yasin:Şeker).Evet Esra:Çiçekdegötürülür. Çiçek.Geneldesaksıdaçiçekalınır,değilmi?(Yasin:Kesinlikle) Ayşegül:Çünküöbürüölecektirzaten.Kalıcıdeğildir. Yasin:Yeninesilde,şeydevardır,(Ayşegül:Buket,Yasin:Haotarzşeyler),giderkenşarapalıp götürme,üniversiteöğrencileriarasındayaygındır. Esra:Küçükhediyelerdealınabilir.Meselabireveyenitaşınmışsabirisimutlakahediyeylegidilir. Buradadahouse warminggiftdiyorlar.amerika dadavarokültür,öylebirgelenekvar. Yasin:Anladım,çokilginç. Ayşegül:İhtiyacıolabilecekşeyler,mutfakeşyaları,küçükevaletleri Ayşegül:Esracığımellerinisağlık.Herşeymükemmeldi Esra:Yaoturuyorduknegüzel!Birçaydahakoyayım. Ayşegül:Sanırımbizartıkkaçalım. Yasin:Dersimizvarveyoğunolacağız.Evet,elinesağlık,çokçokgüzelolmuşveçokgüzeldi. Esra:Afiyetolsun. Ayşegül:Almayalımartık,bukadarçayiçtiğimizyeter. Esra:Peki,afiyetolsun. Yasin:Teşekkürederiz.Ziyadeolsun. Vocabulary(Kaynak:TürkDilKurumu, BüyükTürkçeSözlük) alışkanlık(n):birşeyealışmışolmadurumu, alışkınlık,alışmışlık,alışkı,itiyat,huy, ünsiyet;örnek:yıllarınverdiğialışkanlıkla, kendimdeneminkonuşuyorum. A.Ümit. [Habit,routine] bağlam(n):herhangibirolgudaolaylar, durumlar,ilişkilerörgüsüveyabağlantısı, kontekst;örnek:uygarlıkbağlamındabatı vedoğudiyebirayrımyapılmamaktabir bütünolarakdüşünülmektedir. A.Cemal. [Context]. farklılık(n):1.farklıolmadurumu, ayrımlılık,başkalık;örnek:evvelkilerlebu songörüşümüzarasındakifarklılıkları ölçüyorum. Y.K.Beyatlı.[Difference]. kafasıçalışmak(idiom):düşünebilmek.[to beabletocontemplateaboutsomethink]. öğün(n):1.kez,defa.2.yemekvakti; örnek:heröğüntıkabasayediğiikikatlı ekmekkadayıfıile.. H.E.Adıvar.3.Bir vakitlikyemek.[meal,withanadverbil expressionoftime]. sırayageçmek(v):hizayageçmek, sıralanmak.[togetinaqueue]. (misafir)ağırlamak(v):konuğasaygı göstererekonunhertürlürahatını, gereksiniminisağlamak,ikrametmek,izaz etmek;örnek:benikarşıladılarve ağırladılar. A.Kabaklı.[Tohost,toput somebodyup]. tereddütetmek(v):kararsızdavranmak, duraksamak;örnek:hiçtereddütetmeden maksadımıkendisineanlattım. F.R.Atay. [Tohesitate]. muhabbetetmek(v):karşılıklı,dostça konuşmak;örnek:birgeçittenziyadebir toplantıyeri.mahalleoradamuhabbet eder,konuşur,kavgaeder. H.E.Adıvar.[To haveafriendlychat]. yardımlaşma(k)(n,v):yardımlaşmakişi; örnek:ziragöçebelerinhayatıheran

20 yardımlaşmalarınıgerektirir. C.Meriç.[To aidoneanother;tohelpeachother]. bereketlenmek(v)(bereket,noun): Çoğalmak,artmak;örnek:Doksanyaşına kadaryaşamış,yoklukyüzügörmemişoğul uşaktoplansakocabirmahalleolacakkadar bereketlenmiş. M.Ş.Esendal.[Toincrease; toproliferate]. öpüpalnınakoymak(idiom):değervermek, saygıgöstermek.[tovalue,toregardinhigh esteem]. iltifat(n)(iltifattabulunmak,v):1.birine güleryüzgösterme,hatırınısorma,tatlı EK/APPENDIXII VideoTranscriptofthevideoDriedFruits,DessertsandRestaurant davranma;örnek:gençkızlarerkeklerin iltifatlarınanasılkarşılıkvereceklerini şaşırmışlardı. M.Yesari.2.İlgigösterme, rağbetetme;örnek:kimeiltifatdozunu artırırsaogerçektendebirşeylerolurdu. Ç. Altan.[Compliment]. memnuniyet(n):memnunolma,sevinç duyma,sevinme;örnek:kurutan,yakan güneşlivegölgesizvenihayetsizbirçölün ortasındabirbardakbuzlusubulanyolcu memnuniyetinihissettim. A.H.Müftüoğlu. [Contentment,satisfaction]. Keywords:ürün,elyapımı,kayısı,döner,kadayıf,işlemek(işlenmiş),kurutmak(kurutulmuş), çerez,çeşit,ikrametmek,(etrafını)kaplamak,tüketmek,kavurmak(kavrulmuş),baklava. SpeakerI(Driedfruits): BunlaryinebizimMalatya'nın 17 ürünleri.şuradanbaşlayayım.bunlarpestil 18,bunlaryine Malatya'daüretilenelyapımı.Fabrikasyondeğildir.Bunlardöner 19 dediğimiz,bukayısının döneri.şununezilerek,gülkurusudediğimizkayısınınezilerek,işlenmesindensonrabuşekil alıyor.normalkilogramolarakkesekeseyeniyor.busütlü,içindeantep 20 fıstıklarıvarbunun.o nardöneri,diğerikividöneri.ondansonra,bunlaryinekayısınınürünleri.bunormalbizim bildiğimizistimli(?)kayısı;bugülkurusu.bunlaröyleoşekildegidiyor.şunlardaaynışekilde kayısınınürünleri;üstünefındıkyapıştırdığımızatomdedikleri.budaaynışekildeiçikayısıdır,dışı Antepfıstığı.Şucevizlisi.Diğertaraftakadayıf 21 var,dolmadedikleri,kadayıfdolması;içindebal veantepfıstığıvar;dışıkadayıftırdolmaşeklinde.şudeğişikbirüründür,çokgüzelbirüründür. 17 MalatyaisacityintheeatpartofTurkey.Itisfamousforitsapricotsanddriedfruits. 18 Driedlayersoffruitpulp 19 Pressedlambroastedonalargeverticalspit 20 GaziantepisacityinthesoutheastpartofTurkey.Itisknownforaspecialtypeofnut:pistachionut(calledAntep Fıstığı) 21 Akindofsweetpastry 20




Kerkenes News 12, 2009, fig. 11






Module developed by Yasin Tunç






















































LEVEL: Pre- intermediate EDUCATIVE PROJECT: Tarihi bir mekana dair sunum yapınız / Present a historical site









Durham Research Online

Durham Research Online Durham Research Online Deposited in DRO: 18 February 2015 Version of attached le: Published Version Peer-review status of attached le: Peer-reviewed Citation for published item: Woodhead, Christine (2013)





Mount Nemrut lies 40 km (25 mi) north of Kahta, near Adıyaman, a city in southeast Turkey.

Mount Nemrut lies 40 km (25 mi) north of Kahta, near Adıyaman, a city in southeast Turkey. Dec62010 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING PHOTOHERE (sameasinmodule) CARDNUMBER:2 THEME:TarihselveKültürelMiras/ HistoricalandCulturalHeritage LEVEL:Intermediate FocusonlanguagedevelopedbyYasinTunç


language, culture, and professional biographies. emotions, and exchange opinions in relation with

language, culture, and professional biographies. emotions, and exchange opinions in relation with June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 10 THEME: MESLEKİ ÖZGEÇMİŞLER / PROFESSIONAL BIOGRAPHIES LEVEL: Intermediate EDUCATIVE PROJECTS: 1) The






ENG ACADEMIC YEAR SPRING SEMESTER FRESHMAN PROGRAM EXEMPTION EXAM ENG111 2016-2017 ACADEMIC YEAR SPRING SEMESTER FRESHMAN PROGRAM EXEMPTION EXAM Exam Type Date / Classes / Time Written Thursday, September 22 nd, 2016 Classes & Time to be announced on September 20th.





YABANCI DİL I Zorunlu 1 1 4

YABANCI DİL I Zorunlu 1 1 4 Ders Öğretim Planı Dersin Kodu Dersin Adı Dersin Türü Yıl Yarıyıl AKTS 200001212010 YABANCI DİL I Zorunlu 1 1 4 Dersin Seviyesi Lisans Dersin Amacı After attending the Foreign Language I, students will











Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS Y.DİL III.(İNG.) DKB263 3 2+0 2 3

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS Y.DİL III.(İNG.) DKB263 3 2+0 2 3 DERS BİLGİLERİ Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS Y.DİL III.(İNG.) DKB263 3 2+0 2 3 Ön Koşul Dersleri Dersin Dili Dersin Seviyesi Türkçe Lisans Dersin Türü Yüz Yüze / Seçmeli Dersin Koordinatörü


Açık ve Uzaktan Öğretimde Farklılaştırılmış Öğretim. Hasan UÇAR, Bilecik Şeyh Edebali Üniversitesi Doç. Dr. Alper Tolga KUMTEPE, Anadolu Üniversitesi

Açık ve Uzaktan Öğretimde Farklılaştırılmış Öğretim. Hasan UÇAR, Bilecik Şeyh Edebali Üniversitesi Doç. Dr. Alper Tolga KUMTEPE, Anadolu Üniversitesi Açık ve Uzaktan Öğretimde Farklılaştırılmış Öğretim Hasan UÇAR, Bilecik Şeyh Edebali Üniversitesi Doç. Dr. Alper Tolga KUMTEPE, Anadolu Üniversitesi Farklılaştırılmış Öğretim Adil bir seçim için herkes





Yangın Güvenliği Kursları Eğitim Kayıt Formu

Yangın Güvenliği Kursları Eğitim Kayıt Formu Yangın Güvenliği Kursları Eğitim Kayıt Formu Aon Global Risk Consulting Yangın Güvenliği Kursları için belirlenmiş tarihler, lokasyon, ücret bilgileri ve iletişim bilgileri bu kayıt formunda bulunmaktadır.


STAJ DEĞERLENDİRME FORMU (ÖĞRENCİ) Internship Evaluation Form (Student)

STAJ DEĞERLENDİRME FORMU (ÖĞRENCİ) Internship Evaluation Form (Student) Tarih Date :././ STAJ DEĞERLENDİRME FORMU (ÖĞRENCİ) Internship Evaluation Form (Student) Değerli öğrencilerimiz, Stajınızın tarafımızdan kapsamlı bir şekilde değerlendirilmesi için stajınız hakkındaki



TURKISH DIAGNOSTIC TEST TURKISH DEPARTMENT TURKISH DIAGNOSTIC TEST BY TURKISH DEPARTMENT This examination is designed to measure your mastery of the Turkish language. The test is multiple choices based and is there for diagnostic purposes to assess


Determinants of Education-Job Mismatch among University Graduates

Determinants of Education-Job Mismatch among University Graduates EMLT Project Determinants of Education-Job Mismatch among University Graduates Yılmaz Kılıçaslan Anadolu University Nilgün Çağlarırmak Uslu Anadolu University





Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM

Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM Bu kaynakça çalışmasında 3 adet çağrılı konuşma, 17 adet sözlü bildiri ve 2 adet poster


Virtualmin'e Yeni Web Sitesi Host Etmek - Domain Eklemek

Virtualmin'e Yeni Web Sitesi Host Etmek - Domain Eklemek Yeni bir web sitesi tanımlamak, FTP ve Email ayarlarını ayarlamak için yapılması gerekenler Öncelikle Sol Menüden Create Virtual Server(Burdaki Virtual server ifadesi sizi yanıltmasın Reseller gibi düşünün


Okuma: Tanıdık isim ve kelimeleri, basit cümleleri örneğin; uyarı levhalarını, işaretleri, poster ve katologları okuyabilirim.

Okuma: Tanıdık isim ve kelimeleri, basit cümleleri örneğin; uyarı levhalarını, işaretleri, poster ve katologları okuyabilirim. A1 ÖĞRENCİ (Temel Seviye Kullanıcı) ANLAMA Dinleme: Kendim, ailem ve yakın çevrem hakkında tanıdık kelimeler ve en basit cümle yapılarını yavaş yavaş ve anlaşılır biçimde konuşulduğunda anlayabilirim.





TR2009/0136.01-02/409 Benim için İnsan Hakları «Human Rights for Me» Body of Knowledge for AC/HR Education

TR2009/0136.01-02/409 Benim için İnsan Hakları «Human Rights for Me» Body of Knowledge for AC/HR Education Benim için İnsan Hakları «Human Rights for Me» Body of Knowledge for AC/HR Education Benim için İnsan Hakları «Human Rights for Me» DVE/İHE için Bilgi Bankası FLOW CHART Overall framework: Bologna Functional





D.4.2 Aynı kavram alanına giren kelimeleri, anlam farklılıklarını dikkate alarak kullanır. 1

D.4.2 Aynı kavram alanına giren kelimeleri, anlam farklılıklarını dikkate alarak kullanır. 1 . Deneme 3 Kasım D.4. Aynı kavram alanına giren kelimeleri, anlam farklılıklarını dikkate alarak kullanır. D.4. Kelimeler arasındaki anlam ilişkilerini kavrayarak birbiriyle anlamca ilişkili kelimelere





Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS. İngilizce İNG115 1 3+0 3 3

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS. İngilizce İNG115 1 3+0 3 3 DERS BİLGİLERİ Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS İngilizce İNG115 1 3+0 3 3 Ön Koşul Dersleri Dersin Dili Dersin Seviyesi Dersin Türü Türkçe/ İngilize Lisans Yüz Yüze / Zorunlu Dersin


Eğitim Fakültesi, Kimya Öğretmenliği Programı, Yüzüncü Yıl Üniversitesi. 1999-2004 Eğitim Fakültesi, Kimya Öğretmenliği Lisansla

Eğitim Fakültesi, Kimya Öğretmenliği Programı, Yüzüncü Yıl Üniversitesi. 1999-2004 Eğitim Fakültesi, Kimya Öğretmenliği Lisansla Ünvanı : Yrd. Doç. Dr. Adı Soyadı : Nail İLHAN Doğum Yeri ve Tarihi : Osmaniye- 1981 Bölüm: İlköğretim Bölümü E-Posta: naililhan @ naililhan @ Website:





T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü

T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü Sayı : B.08.0.DİG. /3825 05/05/2010 Konu : Tokyo Dünya Çocuk Resimleri Yarışması..VALİLİĞİNE (İl Milî Eğitim Müdürlüğü) Dışişleri


M.E.B. ENG-4 Ünite-2 STUDENTS-4 UNIT-2 My Classroom ( Sınıfım ) Classroom Language ( Sınıf Dili )

M.E.B. ENG-4 Ünite-2 STUDENTS-4 UNIT-2 My Classroom ( Sınıfım ) Classroom Language ( Sınıf Dili ) 1 M.E.B. ENG-4 Ünite-2 STUDENTS-4 UNIT-2 My Classroom ( Sınıfım ) Classroom Language ( Sınıf Dili ) FUNCTIONS ( FALİYETLER ) Asking for and giving information about classroom object ( Sınıftaki nesneler





Students, who have taken these courses and failed before, are not allowed to take the exemption exams!

Students, who have taken these courses and failed before, are not allowed to take the exemption exams! Muafiyet sınavına aşağıda belirtilen koşulları sağlayan öğrenciler katılabilir; a)eng 101, ENG 111, ENG 102, ENG 112, ING 101 ve ING 102 derslerinin muafiyet sınavlarına, başka bir üniversitenin önlisans,


İnşaat Mühendisliği Bölüm Başkanlığı na

İnşaat Mühendisliği Bölüm Başkanlığı na 15/05/2016 İnşaat Mühendisliği Bölüm Başkanlığı na İnşaat Mühendisliği Bölümü İngilizce ve Türkçe Lisans Programlarının Program Çıktıları hakkında 04-14 Mayıs 2016 tarihleri arasında sadece mezun durumunda


Eleştirel Okuma (İngilizce) (KAM 332) Ders Detayları

Eleştirel Okuma (İngilizce) (KAM 332) Ders Detayları Eleştirel Okuma (İngilizce) (KAM 332) Ders Detayları Ders Adı Ders Kodu Dönemi Ders Saati Uygulama Saati Laboratuar Saati Kredi AKTS Eleştirel Okuma (İngilizce) KAM 332 Güz 4 0 0 4 5 Ön Koşul Ders(ler)i


Nadir Hastalıklar-Yetim ilaçlar. bir sağlık sorunu. Uğur Özbek İstanbul Üniversitesi Deneysel Tıp Araştırma Enstitüsü (DETAE) Orphanet-Türkiye

Nadir Hastalıklar-Yetim ilaçlar. bir sağlık sorunu. Uğur Özbek İstanbul Üniversitesi Deneysel Tıp Araştırma Enstitüsü (DETAE) Orphanet-Türkiye Nadir Hastalıklar-Yetim ilaçlar bir sağlık sorunu Uğur Özbek İstanbul Üniversitesi Deneysel Tıp Araştırma Enstitüsü (DETAE) Orphanet-Türkiye NADİR HASTALIK Prevalansı 1/2000 den az olan hastalıklar NADİR


DERS BİLGİLERİ. Ders Kodu Yarıyıl T+U Saat Kredi AKTS. GSF için Zorunlu İngilizce AFES 101 1 15+9 0 3

DERS BİLGİLERİ. Ders Kodu Yarıyıl T+U Saat Kredi AKTS. GSF için Zorunlu İngilizce AFES 101 1 15+9 0 3 DERS BİLGİLERİ Ders Kodu Yarıyıl T+U Saat Kredi AKTS GSF için Zorunlu İngilizce AFES 101 1 15+9 0 3 Ön Koşul Dersleri Yabancı Dil Hazırlık Okulunda C Kurunu tamamlamak veya İngilizce dil seviye tespit


e-ledger Fields (e-defter Alanları)

e-ledger Fields (e-defter Alanları) e-ledger Fields (e-defter Alanları) Table 1: Field information of the text document (Tablo 1:Yazı Metninin Alan Bilgileri) *Bulut, Lokal Table 2: Field information of the contents in the text document


Kuruluşun Adı / Name of Organisation: Onay Referansı / Approval Reference: Form 13 Referansı / Form 13 Reference: Bölüm 1 Genel / Part 1: General

Kuruluşun Adı / Name of Organisation: Onay Referansı / Approval Reference: Form 13 Referansı / Form 13 Reference: Bölüm 1 Genel / Part 1: General Bölüm 1 Genel / Part 1: General Intermediate audit Change Change Continuation Continuation Kuruluşun Posta Adresi / CAMO s postal address: Kuruluşun email Adresi / CAMO s email address: Kuruluşun Yönetim



GOPRINCE DEVELOPING GOOD PRACTICES : INCLUSIVE EDUCATION IN EARLY CHILDHOOD. Dissemination Activity in Turkey (1) GOPRINCE DEVELOPING GOOD PRACTICES : INCLUSIVE EDUCATION IN EARLY CHILDHOOD Dissemination Activity in Turkey (1) The Portuguese Team engaged in three dissemination activities Country responble Turkey Country

Detaylı EXPORT PANEL CATALOGUE EXPORT PANEL CATALOGUE EXPORT PANEL CATALOGUE ALDORA FURNITURE FACTORY Since its foundation in 2001, Aldora Furniture maintains on its steady growth on 40.000m2 covered factory area in the Industrial Zone of Kayseri



İTÜ DERS KATALOG FORMU (COURSE CATALOGUE FORM) Dersin Adı İTÜ DERS KATALOG FORMU (COURSE CATALOGUE FORM) Course Name Bilimde Önemli Anlar Great Moments in Science Ders Uygulaması, Saat/Hafta (Course Implementation, Hours/Week) Kodu Yarıyılı Kredisi


5İ Ortak Dersler. İNGİLİZCE II Okutman Aydan ERMİŞ

5İ Ortak Dersler. İNGİLİZCE II Okutman Aydan ERMİŞ Listmania Part 2 Ünite 12 5İ Ortak Dersler İNGİLİZCE II Okutman Aydan ERMİŞ 1 Ünite 12 LISTMANIA PART 2 Okutman Aydan ERMİŞ İçindekiler 12.1. PRESENT PERFECT & PAST SIMPLE... 4 12.1.1. Review of verb forms...


Determining some heavy metal concentrations in water and sediments samples taken from Gediz River. Title Institution / University Year

Determining some heavy metal concentrations in water and sediments samples taken from Gediz River. Title Institution / University Year CV Name: Orkide MİNARECİ Date of Birth: 15.01.1972 Academic Title: Assist. Prof. Dr. Education Programme/Department University Bachelor Master Department of Biology (Fundamental and industrial microbiology)


Yangın Güvenliği Kursları Eğitim Kayıt Formu

Yangın Güvenliği Kursları Eğitim Kayıt Formu Yangın Güvenliği Kursları Eğitim Kayıt Formu Aon Global Risk Consulting Yangın Güvenliği Kursları için belirlenmiş tarihler, lokasyon, ücret bilgileri ve iletişim bilgileri bu kayıt formunda bulunmaktadır.


Epi Info Kullanımı AMACI: Epi Info Programı ile veri tabanı hazırlayabilme ve veri girişi yapabilme becerisi kazanmak ÖĞRENİM HEDEFLERİ Epi Info bileşenlerini tanımlayabilmek Epi Info Make View programında


Ho- Chunk Gaming, Hotel &Convention Center, Baraboo WI

Ho- Chunk Gaming, Hotel &Convention Center, Baraboo WI Ho- Chunk Gaming, Hotel &Convention Center, Baraboo WI Ho-Chunk Resort Room Attendant İş Detayları Required Duties: Participants will be cleaning hotel rooms, making beds, stocking carts closer with linen





daha çok göz önünde bulundurulabilir. Öğrencilerin dile karşı daha olumlu bir tutum geliştirmeleri ve daha homojen gruplar ile dersler yürütülebilir.

daha çok göz önünde bulundurulabilir. Öğrencilerin dile karşı daha olumlu bir tutum geliştirmeleri ve daha homojen gruplar ile dersler yürütülebilir. ÖZET Üniversite Öğrencilerinin Yabancı Dil Seviyelerinin ve Yabancı Dil Eğitim Programına Karşı Tutumlarının İncelenmesi (Aksaray Üniversitesi Örneği) Çağan YILDIRAN Niğde Üniversitesi, Sosyal Bilimler


Website review

Website review Website review Generated on October 17 2017 22:54 PM The score is 60/100 SEO Content Title Sorumatik İngilizce Soru Bankası İngilizce Testler ve Sınavlar Length : 62 Perfect, your title


STAJ DEĞERLENDİRME FORMU (İŞVEREN) Internship Evaluation Form (Employer)

STAJ DEĞERLENDİRME FORMU (İŞVEREN) Internship Evaluation Form (Employer) STAJ DEĞERLENDİRME FORMU (İŞVEREN) Internship Evaluation Form (Employer) İTÜ, Tekstil Mühendisliği Bölümü Tarih Date :././ Değerli işveren, Öğrencimizin Firmanızda gerçekleştirmiş olduğu stajın tarafımızdan


Öğrenim Durumu: Derece Bölüm/Program/Alan Üniversite Bitirme Yılı Lisans Fizik / Fen Edebiyat / Fizik Dicle Üniversitesi 2004

Öğrenim Durumu: Derece Bölüm/Program/Alan Üniversite Bitirme Yılı Lisans Fizik / Fen Edebiyat / Fizik Dicle Üniversitesi 2004 ÖZGEÇMİŞ ve ESERLER LİSTESİ Genel Bilgiler: Adı Soyadı : Cihat DEMİR Doğum Yeri ve Tarihi : Diyarbakır - 14 Haziran 1982 Yazışma Adresi : Dicle Üniversitesi Ziya Gökalp Eğitim Fakültesi İlköğretim Bölümü


One Crazy Story. Dialog. Turkish Tea Time. Lesson 12. görevlisi ile tanıştık.

One Crazy Story. Dialog. Turkish Tea Time. Lesson 12. görevlisi ile tanıştık. Lesson 12 One Crazy Story Turkish Tea Time Made with love. Ever have one of those nights? You know, the kind you can't wait to tell all your Turkish friends about the next day? Before


First Stage of an Automated Content-Based Citation Analysis Study: Detection of Citation Sentences

First Stage of an Automated Content-Based Citation Analysis Study: Detection of Citation Sentences First Stage of an Automated Content-Based Citation Analysis Study: Detection of Citation Sentences Zehra Taşkın, Umut Al & Umut Sezen {ztaskin, umutal, u.sezen} - 1 Plan Need for content-based


Profiling the Urban Social Classes in Turkey: Economic Occupations, Political Orientations, Social Life-Styles, Moral Values

Profiling the Urban Social Classes in Turkey: Economic Occupations, Political Orientations, Social Life-Styles, Moral Values Profiling the Urban Social Classes in Turkey: Economic Occupations, Political Orientations, Social Life-Styles, Moral Values Presentation of the Basic Findings of a Public Opinion Survey Supported with


Physics Education in Turkey IV. FEN BİLİMLERİ EĞİTİMİ KONGRESİ 6 / 10 / 2000 8 / 10 / 2000 ANKARA

Physics Education in Turkey IV. FEN BİLİMLERİ EĞİTİMİ KONGRESİ 6 / 10 / 2000 8 / 10 / 2000 ANKARA Physics Education in Turkey IV. FEN BİLİMLERİ EĞİTİMİ KONGRESİ 6 / 10 / 2000 8 / 10 / 2000 ANKARA Bu kaynakça çalışmasında 18 adet sözlü bildiri Arş. Gör. M. Şahin BÜLBÜL tarafından listelenmiştir. 4 th


Physics Education in Turkey VI. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 9 / 10 / 2004 11 / 10 / 2004 İSTANBUL

Physics Education in Turkey VI. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 9 / 10 / 2004 11 / 10 / 2004 İSTANBUL Physics Education in Turkey VI. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 9 / 10 / 2004 11 / 10 / 2004 İSTANBUL Bu kaynakça çalışmasında 19 adet sözlü bildiri Arş. Gör. M. Şahin BÜLBÜL tarafından


Islington da Pratisyen Hekimliğinizi ziyaret ettiğinizde bir tercüman istemek. Getting an interpreter when you visit your GP practice in Islington

Islington da Pratisyen Hekimliğinizi ziyaret ettiğinizde bir tercüman istemek. Getting an interpreter when you visit your GP practice in Islington Islington da Pratisyen Hekimliğinizi ziyaret ettiğinizde bir tercüman istemek Getting an interpreter when you visit your GP practice in Islington Islington daki tüm Pratisyen Hekimlikler (GP) tercümanlık


CURRICULUM VITAE. Assistant Prof. Dr. Birim BALCI

CURRICULUM VITAE. Assistant Prof. Dr. Birim BALCI CURRICULUM VITAE Assistant Prof. Dr. Birim BALCI 1- Name and Surname : Birim BALCI 2- Date of Birth : 28.07.1975 3- Department : Computer Engineering 4- Education: Degree Department University Year Bachelor


Inventory of LCPs in Turkey LCP Database explained and explored

Inventory of LCPs in Turkey LCP Database explained and explored Inventory of LCPs in Turkey LCP Database explained and explored Hakan Hatipoglu Antalya, 9 October 2015 Requirements and specifications (TOR) Web based database application that will: Support Inventory








Reading and Vocabulary. Reading Words Vocabulary bölümü, gruplandırılmış kelimeler üzerinde çalışmalar.

Reading and Vocabulary. Reading Words Vocabulary bölümü, gruplandırılmış kelimeler üzerinde çalışmalar. Grammar Reading and Vocabulary Test Teknikleri Ödev 1.gün Verb tenses&passive Voice Akın test kitabı Konu belirli bir kaynağa bağlı kalınmadan ve KPDS-ÜDS nda çıkan biçimiyle test kitabındaki sorular üzerinde





Principles of Atatürk & History of the Turkish Atatürk İlkeleri ve İnkılâp Tarihi I revolution I

Principles of Atatürk & History of the Turkish Atatürk İlkeleri ve İnkılâp Tarihi I revolution I I I. YIL HAFTALIK DERS SAATI FBÖ 101 Z Genel Fizik I General Physics I (4+0) -4 6 FBÖ 151 Z Genel Fizik Lab. I General Physics Lab. I (0+2) -1 2 FBÖ 103 Z Genel Kimya I General Chemistry I (4+0) -4 6 FBÖ


GASTRONOMİ VE MUTFAK SANATLARI - 1. YARIYIL. Academic and Social Orientation. 345000000001101 Genel İşletme General Business 3 0 0 3 3 6 TR

GASTRONOMİ VE MUTFAK SANATLARI - 1. YARIYIL. Academic and Social Orientation. 345000000001101 Genel İşletme General Business 3 0 0 3 3 6 TR GASTRONOMİ VE MUTFAK SANATLARI - 1. YARIYIL 141000000001101 Akademik ve Sosyal Oryantasyon Academic and Social Orientation 1 0 0 1 0 1 TR 345000000001101 Genel İşletme General Business 3 0 0 3 3 6 TR 811000000001103


! HANDE YILDIRIM Personal Information Date of Birth: 13.06.1990 Address: E-mail: Phone: 5068603514 URL: Medicine Department of Education PhD/Medical Specialization 1.12.2014-present


AB surecinde Turkiyede Ozel Guvenlik Hizmetleri Yapisi ve Uyum Sorunlari (Turkish Edition)

AB surecinde Turkiyede Ozel Guvenlik Hizmetleri Yapisi ve Uyum Sorunlari (Turkish Edition) AB surecinde Turkiyede Ozel Guvenlik Hizmetleri Yapisi ve Uyum Sorunlari (Turkish Edition) Hakan Cora Click here if your download doesn"t start automatically AB surecinde Turkiyede Ozel Guvenlik Hizmetleri


Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS. Yüz Yüze / Zorunlu / Seçmeli

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS. Yüz Yüze / Zorunlu / Seçmeli DERS BİLGİLERİ Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS İngilizce ING105 1 2+0 2 2 Ön Koşul Dersleri Dersin Dili Dersin Seviyesi Dersin Türü Türkçe Lisans Yüz Yüze / Zorunlu / Seçmeli Dersin


Topluluk Önünde Konuşma (İngilizce) (KAM 432) Ders Detayları

Topluluk Önünde Konuşma (İngilizce) (KAM 432) Ders Detayları Topluluk Önünde Konuşma (İngilizce) (KAM 432) Ders Detayları Ders Adı Ders Kodu Dönemi Ders Saati Uygulama Saati Laboratuar Saati Kredi AKTS Topluluk Önünde Konuşma (İngilizce) KAM 432 Güz 4 0 0 4 5 Ön


Pre-inter. modules We have added four preintermediate

Pre-inter. modules We have added four preintermediate Newsletter About DATTL The Deep Approach to Turkish Teaching and Learning (DATTL) is embodied in François Victor Tochon s deep approach to language instruction that encompasses the social, cultural, demographic,





2 Ders Kodu: BIL Ders Türü: Seçmeli 4 Ders Seviyesi Yüksek Lisans

2 Ders Kodu: BIL Ders Türü: Seçmeli 4 Ders Seviyesi Yüksek Lisans UZAKTAN EĞİTİMDE KURAM ve UYGULAMA 1 Ders Adi: UZAKTAN EĞİTİMDE KURAM ve UYGULAMA 2 Ders Kodu: BIL5109 3 Ders Türü: Seçmeli 4 Ders Seviyesi Yüksek Lisans 5 Dersin Verildiği Yıl: 1 6 Dersin Verildiği Yarıyıl


ÖZGEÇMİŞ. Derece Alan Üniversite Yıl. OrtaöğretimMatematikEğitimi BoğaziciÜniversitesi 2007

ÖZGEÇMİŞ. Derece Alan Üniversite Yıl. OrtaöğretimMatematikEğitimi BoğaziciÜniversitesi 2007 ÖZGEÇMİŞ 1. AdıSoyadı: Rukiye Didem Taylan 2. DoğumTarihi: 25 Temmuz 1984 3. Unvanı: Yrd. Doç. Dr. 4. ÖgrenimDurumu: Derece Alan Üniversite Yıl Lisans OrtaöğretimMatematikEğitimi BoğaziciÜniversitesi 2007



