Module developed by Yasin Tunç

Ebat: px
Şu sayfadan göstermeyi başlat:

Download "Module developed by Yasin Tunç"

Transkript

1 1 June13,2011 ADEEPAPPROACH TOTURKISHSUGGESTION CARDFORSELF DIRECTEDLEARNING CARDNUMBER:5 THEME:TURKISHCUISINEANDCULTURE TÜRKMUTFAĞIVEMUTFAKKÜLTÜRÜ LEVEL:Intermediate EDUCATIVEPROJECTS: 1.ExploreTurkisheatinghabits 2.Shareandenactyourknowledgeoftypes offoodinturkey ModuledevelopedbyYasinTunç LANGUAGESTANDARDSBEINGDEVELOPED (SeeACTFLStandards): Communication(1.2):Understandand interpretwrittenandspokenlanguageona varietyoftopicsrelatedwithfood,dining andculinaryarts;(1.3)presentinformation, concepts,andideastoanaudienceof listenersorreadersonsuchtopics. Cultures(2.1):Demonstratean understandingoftherelationshipbetween culinarypracticesand perspectivesinturkishculture. Connections(3.2):Recognizethedistinctive viewpointsthatareonlyavailablethrough theturkishlanguageandculture. Comparisons(4.2):Demonstratean understandingoftheconceptofculture throughcomparisonsoftheturkishculture, Americancultureorotherindigenous cultures. Communities:Prepareadinnerand participateinaturkishnightwiththelocal community. MINDMAP MAINVIDEOSUSEDINTHE MODULE TurkishEatingHabits1&2 DriedFruits,Desserts,and Restaurant ADDITIONALVIDEOS Cheese,Foodandspices Kadayıf,Markettalk,Simit vendors,yeşilelma.

2 2 1) BAĞLAM/CONTEXT Throughthetheme TurkishCuisineand Culture youwillgetacquaintedwiththe characteristicsofdifferentcuisinetypesin TurkeyandwithTurkisheatinghabits.By watchingvideos,listeningtointerviews, searchingtheinternet,andreadingarticles, youwillacquireinsightsintotheturkish eatinghabits,differenttypesoffoods,and distinguishingculturalelementsinmodern Turkey.Whileidentifyingeatinghabitsfrom themediamaterial,youwillhavethechance tomakeacomparisonbetweenyournative cuisineandeatinghabitsandturkishcuisine andeatinghabits. MEKANVEZAMAN/SPACEANDTIME Throughthisthemeandprovidedinternet links,youwillhavethechancetolearnabout OttomanCuisineandsomeitscharacteristics andabouteatinghabitsandthetypeoffood consumedindifferentregionsinturkey. 2) TEMATİKPROJELER/THEMATICPROJECTS Twoprojectsaresuggestedforthetheme TurkishCuisineandCulture. InProject1,onesuggestedactivityistowatch thevideoturkisheatinghabits,wherethree Turkishuniversitystudentsstudyinginthe UnitedStates,talkaboutthedifferences and/orsimilaritiesbetweenturkisheating habitsandthoseofothercultures(particularly American).Itisrecommendedthatyouspot asmanyfeaturesofturkisheatinghabitsas possibleandcomparethemtothoseofyour ownnativeculture.anotherrecommended activityisthatyoureadanarticle,focusingon Turkisheatinghabits,andelicittheparticular characteristicsanddiscusstheminyour group.thereadingcanbedoneoutsidethe classroom. InProject2,onesuggestedactivityistowatch somevideosondifferenttypesoffood dessert,drinks,etc.youshouldtrytogetas muchinformationaspossiblethroughvideos andinternetsitesaboutthecharacteristicsof Turkishcuisine.Thereadingpassageusedin thepreviousprojectcouldbehelpfulhereas well,withareadingextractfromtheinternet byafamousturkishcookonthe characteristicsofturkishcuisine.then,in groups,youshouldprepareapresentationon atypeoffood,dessert,drinks,snacksand driedfruits(indigenoustoturkey).youshould presenttheoriginofthemeal,talkaboutthe regionwheretheyarepopular,whentheyare consumed,whattheingredientsare,and finallyarecipeforthem.

3 PROJECT1:TüRKLERİNYEMEALIŞKANLIKLARINIİNCELEYİNİZ EXPLORETURKISHEATINGHABITS TABLE1INSTRUCTIONALORGANIZERSandEMBEDMENTMAP IdentifyingTurkisheatinghabitsandcomparingthemwithyourown ACCESS VOICE INTERPRET ANALYZE PRESENT INTERACT READ/WATCH/LISTEN Watchandlistentoa filmedconversation betweenthreeturkish students(studyingin theunitedstates). Readthe transcriptions. Readanarticleon Turkisheatinghabits. ACTION: Organizeagroup discussion;shareyour comparisonsofeating habitsindifferent cultures. FOCUSONLANGUAGE Usediscoursemarkers /connectives(söylem ifadeleri:işte,hani, şey,yanietc.). Usequestiontag: değilmi? Useduplications:var var,dizidizi,... Passiveforms(present simple/continuous). THEME: Culturalcharacteristics ofturkisheating habits. WRITE/SPEAK/RECORD Writedownthe characteristicsof Turkisheatinghabits. Writeanoutlinefora compare contrast paragraph. Compareandcontrast Turkisheatinghabits andthoseofyourown culture. EXCHANGEANDACT Debateaboutthe distinctive characteristicsof Turkisheatinghabits. CompareTurkish eatinghabitstothose ofyournativeculture andvariousother cultures. OPERATIONS: Takenote;skimandscan; compareandcontrast;writea paragraph;usesentence connectors. ÖNERİLER/GUIDELINES A.NELERYAPACAĞIM? 1. İkiliyadaüçlügruplarşeklindevideonun izlenmesi. 2. Türkiye dekiyemekyemealışkanlıklarının videoveinternetsiteleriaracılığıyla belirlenmesi. 3. Bunlarıngruplarhalindetartışılması 4. Belirlenenözelliklerinöğrencilerinkendi kültürleriylekarşılaştırılmasıvefarklılık ve/veyabenzerliklerinbelirlenip tartışılması. 5. Türkler'dekiyemekyemealışkanlıklarına dairbelirlenenmakaleninokunup tartışmanındahaakademikbirboyut kazanması. 6. Makaledebelirleneneknoktaların tartışılması A.WHATAMIGOINGTODO? 1.Watchthevideosinpairsoringroupsof three. 2.IdentifyTurkisheatinghabitsbywatching videosanddoingresearchontheinternet. 3.Discussthehabitsyouhavediscoveredin groups. 3

4 4.Comparethehabitsyouhavefoundto yourownculture,anddiscussthe differencesand/orsimilarities. 5.ReadthearticlerelatedtoTurkisheating habitssothatthetopiccouldbediscussed inamoreacademicdiscourse; 6.Discussadditionalaspects(ifany) mentionedinthearticlerelatedtoturkish eatinghabits. B.NASILTARTIŞMALIYIM? 1. Videonunizlenmesi 2. Videodatartışılannoktalarınnotalınması 3. Gruplaraayrılaraknotlarınpaylaşılması. Bunotlardan(öğrencilerinkendi kültürleriyle)karşılaştırmanoktalarının belirlenmesi 4. İkili/üçlügruplarhalindeyerelkültürile Türkler'dekiyemekyemealışkanlıklarının karşılaştırılması. B.HOWTODEBATETHEISSUE? 1.Watchthevideo; 2.Jotdowndetailsmentionedinthevideo; 3.Getintogroupsandshareyournoteswith othergroupmembers; 4.Compare/ContrastTurkisheatinghabits withthoseofyourowninpairs,small groups,orasawholeclassdiscussion. MATERIALSforProject1: Video:TurkishEatingHabits1 2(totalof14min) This2 partvideofeaturesthreeturkishstudentsstudyingintheunitedstates,talking aboutturkisheatinghabitsandmakingcomparisonswithamericaneatinghabits.they commentonturkishcuisineandmentionsomeofitscharacteristics.theconversationis mostlyfocusedonmealcourses(i.e.,breakfastanddinner)andexpressionsthatareused beforeeatingadinnerandwhenoneisfinishedeating.commentsaremadeongivinggifts whenvisitingsomeone. See AppendixI forthetranscriptofthevideoattheendofthemodule. Text 1 :Türkler'deYemekYeme AlışkanlıklarıveBunaİlişkin DavranışKalıpları. TextonTurkisheatinghabits withenglishsummary. 1 WithpermissionofTürkKültürVakfı[TurkishCultural Foundation]retrievedfrom(seealsothewholearticle) =2. 4

5 Türkler'deYemekYemeAlışkanlıklarıveBuna İlişkinDavranışKalıpları Doç.Dr.MahmutTezcan 2 Keywords:davranışkalıpları,mutfak, zenginlik,pastırma,kebap,nitelik, etkile(n)mek,tarımsal,ekonomikyapı, hububat Canboğazdangelir UzunbirtarihselgeçmişesahipTürkler, mutfakkonusundazenginbirkültüre sahiptirler.buzenginlik,kendisinibolçeşitli yemeklerdegöstermektedir.ayrıca,tüm yiyecekveiçeceklereilişkindavranışkalıpları geliştirilmiştir. Yemekzenginliğiniifadeedenbirkaçörnek verebiliriz.örneğinsadecekaradeniz 3 bölgesindebilinenmısırkarışımıyemekler yirmiyigeçer.yinekaradenizyöresinde hamsidenyapılanyemektürlerininaşağıda belirteceğimizisimleridemutfakzenginliğimizi gösterir.hamsininiçlitavası,hamsiliekmek, hamsipilavı,hamsikayganası,tavası,köftesi, hamsiiçlitavası,hamsidiblesi,hamsi haşlaması,hamsiızgarası,hamsiböreği,hamsi buğulamasıgibi. Kayseri 4 deyirmitürlüpastırmasöz konusudur.biryazarımızşöylediyor: Yirmi türlüpastırmanınherbirininayrıözelliği,ayrı tadıvar.birkayseriliye, Sayyirmitürlü pastırmanınadını dediğimizzamansaymaya başlar. Sırt,kuşgömü,kenarmehle,eğrice, omuz,dilme,şekerpare,kürek,kapak,döş, etek,bacak,ortabez,kavrama,meme,kelle, kanlıbez,arkabas,tütünlük. (Gümüşkaynak:1966) Patlıcandanyapılanyemektürleri,salatalarve kebaptürlerimizoldukçazengindir.bıldırcın kebabı,çevirmekebabı,kuzuçevirme,çöp 2 AnkaraÜniversitesiEğitimFakültesiÖğretimÜyesi [AssociateProfessoratAnkaraUniversity]. 3 BlackSeaRegion(NorthofTurkey). 4 Kayseri:AcityincentralAnatolia. 5 kebabı,çubukkebabı,şişkebabı,derikebabı, pidelikebap,adanakebap,saçkebabı,tas kebabı,tandırkebabıbunlardansadecebirkaç örnektir. Anadoluyemekleriningenelliklebitkilerden, etlerdenvehamurdanolmaküzereüç kaynaktanoluştuğunugörmekteyiz. Türkyiyeceklerinegenelolarakbakacak olursak,aşağıdakinitelikleresahipolduğunu görürüz: Göçebelikvetarımsalekonomikyapı,Türk yemeklerinietkilemiştir. Yemeklerülkemizincoğrafibölgelerinegöre çeşitlilikgöstermektedir. Ailelerinsosyo ekonomikdüzeylerinegöre yemeklerdegenelliklebirfarklılaşmagörülür Yemekçeşitleribakımındanbaşka kültürlerdenetkilenmeveonlarıetkilemesöz konusudur. Dinselyapımızvenormlarımız,değerlerimiz mutfağımızıetkilemiştir. Beslenmealışkanlıklarındabirölçüdecinsel farklılaşmadagörülür. Tarımsalekonomikyapıdaözelliklehububatlar Türkyiyeceklerininçoğunluğunuoluşturur. Kurufasülye,yadanohut,bulgurpilavıve yanındabirsoğan,adetatürkyiyeceğinin simgesiolmuştur.özelliklekırsalkesiminen popüleryiyeceğibunlardır.anadolu yollarındakilokantalardayemekyerken garsonlarınençok Birkuru biçimindeki sesleriniduymazmıyız?askerliktenekadar çokyenirseyensin,fıkralara,şakalaşmalarane kadarkonuolursaolsun,kurufasulyeyinede vazgeçilmezbirtürkyemeğidir. AvrupaveAmerikankültürlerininaksine,daha çoksuluolarakpişirilenyemekleryenir. Sebzelerinvehububatınçoğukıymalı,kuşbaşı etli,soğanlıolaraksuilepişirilipyenir.bu nedenleçorbanınçokzenginçeşitlerinitürkler geliştirmişlerdir.kırsalkesimdekahvaltıolarak çorbanıntercihedilişibugünbilegeçerlidir.

6 6 Vocabulary(Kaynak:TürkDilKurumu,Büyük TürkçeSözlük) davranışkalıpları:tektekdavranışları açıklamayaveortakbirtanımdatoplamaya yarayanuyumludavranışlarörüntüsü. [Behaviorpatterns]. karışım:(a)birdençokşeyinkarıştırılmasıyla eldeedilenveyaortayaçıkanşey;örnek: Melezbirinsanırkınınkarışımı,buadama kuvvetvermiş. M.Ş.Esendal.[Mixture] nitelik:(a)1.birşeyinnasılolduğunubelirten, onubaşkaşeylerdenayıranözellik,vasıf, keyfiyet;2.birşeyiniyiveyakötüolma özelliği,kalite.[quality,property,attribute]. göçebelik:(a)birtoplumsalbirliğin,yaşamak içingereklikaynaklarıeldeedebilmeküzere düzenliaralıklarlayerdeğiştirmegeleneğinde veyaalışkanlığındaolması.[nomadism, migration]. etkilemek:(f)etkiyeuğratmak,tesiretmek; örnek:toplumuetkileyenolaylaraherkeskendi yorumunukatıyor. N.Cumalı.[Toaffect sb/sth]. hububat:(a)tahıl;örnek:benimmemleketim deziraataelverişlidir,hububatyetiştirir. R.H. Karay.[Cereal,grain] SUMMARY Withalonghistory,Turkshavearichcuisine, whichisevidentinthedifferenttypesoffood eateninturkey.eatinghabitswithawide varietyoffooddifferfromregiontoregion andevenfromtowntotown.nevertheless, therearemanycommoncharacteristicswith regardtoeatinghabitsinturkey.thispaper focusesonthesecommonandshared characteristics. Therearemanyexamplesreferringtothe richnessofturkishcuisine.forexample,inthe BlackSearegion,onecanseemorethan twentytypesofmealsthatcontaincornor cornproducts.therearealsomanytypesof mealsthatcontainanchovysuchasanchovy pilaf,friedanchovy,andgrilledanchovy.in Kayseri,inCappadocia,youcanfindmore thantwentytypesofpemmican.also,kebabs, salads,andmealsmadeupofeggplantare variedandrich. ItisobviousthatAnatoliancuisineismadeup ofthreesources:plants,meat,anddough.all thesehavebeenusedsinceancienttimes.as amatteroffact,thereisaconnection betweentypesoffoodandcivilizationofa culture.thecharacteristicsofthecuisineofa countrygivecluesaboutitscivilization. Turkishfoodtypeshavevariedfrom civilizationtocivilization,whichhasshaped thelandandimpactedcurrenteatinghabitsof Turkishpeople. Wecanobservethefollowingcharacteristics whenwelookatfoodsconsumedinturkey: Nomadismandagriculturaleconomic structurehaveaffectedturkishfoods. Foodsvaryintermsofgeographical regions. Thesocio economiclevelsofpeoplehave aneffectontheirfood. Turkishcuisinehasinfluencedandhas beeninfluencedbyotherculturesinterms ofthevarietyoffoods. Thereligiousstructureandnormsof Turkishsocietyhaveinfluencedthe cuisine. Thereisacertainextentofgender differenceaswellintermsofeating habits.

7 7 Cereals,especially,accountformostof Turkishmeals.Drybeans,chickpea,and bulgurpilafwithanonionhavebeenasymbol ofturkishcuisine.thesearethemostpopular foodsoftheruralareas. UnlikeEuropeanandAmericancultures,in Turkeypeoplemostlyeathome cooked meals.mostofthevegetablesandcerealsare cookedinwaterwithmincedmeat,steak (kuşbaşıet)andonion.turkshavecomeup withmanytypesofsoupsuchastarhana a traditionalturkishcerealfoodconsistingof flour,yogurt,andvegetablesfermentedthen dried gruel(unçorbası),lentilsoup,soup withyogurt,andricesoup. PROJECT2: TÜRKMUTFAĞINADAİRBİLGİLERİPAYLAŞINVEUYGULAYIN SHAREANDENACTYOURKNOWLEDGEOFTYPESOFFOODINTURKEY TABLE2INSTRUCTIONALORGANIZERSandEMBEDMENTMAP Presentingorpreparingatypeoffood/drink/dessert ACCESS VOICE INTERPRET ANALYZE PRESENT INTERACT READ/WATCH/LISTEN Watchandlistento videosaboutthe differenttypesoffood. Skimthroughthe differentinternetsites providedandtake notesonrecipesand thecharacteristicsof variousmeals. FOCUSONLANGUAGE Passive(present simple). Presentformoftobe Dir (DIr) Passive(present simple/continuous) WRITE/SPEAK/RECORD Writearecipeforat leasttwotypesoffood indigenoustoturkey, tryitoutathome,and thensharetheproduct withyourfriends. EXCHANGEANDACT Discusswhatkindsof food,drinks,and dessertareconsumed inturkey. Presentthe characteristicsof differenttypesoffood inturkey. ACTION: CookfortheTurkish Night;present differenttypesoffood inturkey. THEME: Turkishcuisine. OPERATIONS: Internetsearch;writerecipes;use descriptivediscourse.

8 ÖNERİLER/GUIDELINES A.NELERYAPACAĞIM? 1. Videonun(vesağlananalternatif videoların)izlenmesi. 2. Türkiye detüketilenfarklıyiyecekleredair notlaralınması. 3. Buyiyecektürleriningruplandırılması (yemekler,tatlılar,kuruyemişler, içecekler). 4. Sunumgruplarınınbelirlenmesivesunum konusunun(içeriğinin)belirlenmesi. B.NASILSUNMALIYIM? 1. Öncelikleeldeedilenbilgileringözden geçirilmesi. 2. Gruplarınbelirlenmesi. 3. Hergrubunbelirlenenyiyecek gruplarından(yemekler,tatlılar,kuru yemişler,içecekler)sunumiçinbirertür belirlemesi. 4. Sunulacakyiyecekveiçecektürleri hakkındaderinbilgitoplanması(resim, video,makale,vs.). 5. Bilgilerinorganizeedilmesivesunulması 6. Sunumlaberabersınıftakidiğerbireylere sunulanyemeklerintariflerinin hazırlanması. MATERIALSforProject2 VideoDriedFruits,DessertsandRestaurant(7 min)withthreeinterviews.thefirstinterview isaboutapricotsanddriedfruits,thesecond oneisaboutbaklavaanddessert,andthe thirdoneisaboutdifferentdishtypesfoundin arestaurant(lokanta).see AppendixII for A.WHATAMIGOINGTODO? 1.Watchthevideoandotheralternative videos(iftimepermits). 2.Takenotesonthedifferenttypesoffood consumedinturkey. 3.Categorizethefoodunderheadings,such asfood,desserts,driedfood,anddrinks. 4.Determinethepresentationgroupand topic. B.HOWSHOULDIPRESENT? 1.Revisethenotesyouhavetaken. 2.Determineyourgroup. 3.Determinethetypeoffood,driedfood, dessert,anddrinksthatyouaregoingto present(asagroup). 4.Dodeeperresearchonthethingsthatyou aregoingtopresent. 5.Organizetheinformationyouhave collected,andpresentit. 6.Preparearecipeforthefoodyouaregoing topresenttotheclass. thetranscriptofthevideoattheendofthe module. TextTÜRKMUTFAĞININÖZELLİKLERİ expressescharacteristicsofturkishcuisine. 8

9 TÜRKMUTFAĞININÖZELLİKLERİ 5 Yazan:AYDINYILMAZ 6 TürkMutfağınınÖzellikleri AydınYılmaz Keywords:hamurişi,çeşit/tür,haşlamak, kavurmak,baharat,zeytinyağlı,tatlı,çorba. PassiveStructures TürkMutfağındayemeklerinekmekleyenmesi esastır. Hamurişlerivepilavlarönemlidir. Kebaplarınyanısıraetyemeklerininçeşitleride boldur. Sebzelerhaşlanmışolarakdeğil,et,soğan, domatesveyasalçalıpişirilirler. Çoğunluklayemeklerekonansoğan,kıyma,et, salçasukonmadanönceyağdakavrulur. Soğanvebazıyemeklerdedesarmısak yemeğinanamalzemesidir. Çokçeşitlisebzekullanılırveaynısebzeden çoksayıdayemektürüyapılır.tencereyemeği hakimdir. Yakınzamanakadarkullanılantereyağı,içve kuyrukyağlarıkullanımınıazaltmaktadır. Soğukyemeklerinanamalzemesi zeytinyağlıdır.zeytinyağınınpilav,salatave kızartmalardagenişkullanımyerivardır. BulgurenazpirinçkadarTürkMutfağına hakimdir(köfte,çorba,salatav.s.). Kurumeyveler,hoşafvekompostoyapımında kullanıldığıgibi,bazıyörelerdeyemeklerdede kullanılmaktadır. Baharat,çeşitvemiktarolarakyemeklerdeaz kullanılır.ençokkullanılankarabiber,kırmızı biber,tarçın,kimyon,yenibahar,nane,kekik, fesleğen,çörekotu,susamgibibaharatlardır. Maydanoz,dereotu,naneTürkyemeklerinde genişölçüdekullanılır. Yoğurtyemekmalzemesigibikullanılır. Tabaksüslemeveboyamasanatıyeniyeni gelişmektedir. Yemeklerpişirilirkentuzukonur. Tatlıçeşitleriçokfazladır.Hamurvesütlü tatlılarhakimdir.ayrıcahelvaçeşitleri yaygındır. Yemeklerarasındaşıra,şerbet,ayranveturşu sularıiçilir. TürkMutfağındakoyunetihakimdir.Dana, tavukvebalıketikullanımıartmaktadır. Türkmezetabağındazeytinyağlılar,börekler, peynirlerveçiğyenebilensebzelerhakimdir. Türketlerikesimfarkındandolayıdahaaz kalındırvebulezzetfarkıyaratmaktadır. TürkMutfağındadonmuşetvesebze kullanılmaz.konservesebzelerfazla benimsenmemiştir. Türkyemeklerininçoğuiçinözelkap kacağa ihtiyaçvardır. Çorbamönünündemirbaşıdır. Türkyemeğindeçeşitlerinsunuluşsırası farklıdır. Evmutfağıileticarimutfakarasındaçeşit yönündenfarklılıklarvardır. 5 Source:http://www.umityilmaz.net/ozellikler.htm, retrievedfromthissiteon9/17/ AfamouscookinTurkey. 9

10 10 Vocabulary(Kaynak:TürkDilKurumu,Büyük TürkçeSözlük) hamurişi:hamurdanyapılanyiyeceklerin geneladı.[pastry]. yanısıra:yanında,birlikte.[inaddition]. hakimolmak:(f)1.buyruğunuyürütmek, egemenliğinisürdürmek;örnek:birmilletin ruhuzaptolunmadıkça,birmilletinazimve iradesikırılmadıkçaomilletehâkimolmanın imkânıyoktur. Atatürk.2.Etkiliolmak, hükmetmek.[todominate]. haşlamak:(f)sudakaynatarakpişirmek; örnek:ninem,yoldayerimdiyeikiyumurta haşladıydı. H.E.Adıvar.[Toboil]. donmak:(f)1.sıvı,soğuğunetkisiylekatı durumagelmek,buztutmak.2.yaşamını yitirmek,soğuktanölmek;örnek:donmak üzereolaninsanlarıntatlılığınıiçimde duymayabaşladım. S.F.Abasıyanık.3.Çok üşümek.[freeze]. benimsemek:(f)1.birşeyikendinemaletmek, sahipçıkmak,kabullenmek,tesahupetmek. [Toadopt,embrace,andinternalize]. demirbaş:(a)1.biryerdekullanılan,biryere kayıtlıolan,birgörevlidenöbürüneteslim edilendayanıklıeşya;örnek:salonun demirbaşıolanpiyano,yağmurlugünlerde çocuklarıneğlenmesiiçinkullanıldı. A.Kutlu. [permanentorheavyfixturesorequipment]. ALTERNATIVEVIDEOS Avideooncheese:Thespeakertalksaboutatypeofcheeseindigenoustosomelocalareasin Turkey.Hetalksabouthowthatspecifictypeofcheeseismadeandhowitispreserved. Foodandspices:ThespeakertalksaboutdifferenttypesofspicesusedinTurkey. Kadayıf:Thespeakertalksabouthowatypeofpastry(dessert) kadayıf ismade. Markettalk:ThisvideocouldbeusefulforTurkishlearnerswhoarenotfamiliarwith bazaar/market/farmers'markettalk. Simitvendors(time1.36totheend):Thisvideo couldbeusefultodiscusstheroleofsimitin manypeople'slives.itcouldbeusedtodiscuss thesocio economicstructuresinturkey, especiallyinbigcities. Yeşilelma:Thisvideohighlightsthedynamicsof food,culture,andfamilyrelationsinturkish culture.itisacookingprogramshownona Bayramday.Therefore,therearemanylocal elementsanddialoguesonbayram. 3) İNTERNETBAĞLANTILARI/INTERNETINTERNETLINKS Bütünilleringenelmutfaközellikleri:Thissitepresentsdifferenttypesoffoodindigenousto eachcityinturkey.http://mhz.uni.cc/trkiyenin yresel yemekleri lezzet haritasi hangisehir hangi yemekle meshur/ Trakyayöresi:Tekirdağmutfağı:Thissiteprovidesinformationonthefoodindigenoustothe ThracianregioninTurkey. BatıTrakyamutfağı(özellikleri):Thissiteprovidesinformationonthefoodindigenousto ThracianregioninTurkey Türkler'deYemekYemeAlışkanlıklarıveBunaİlişkinDavranışKalıpları:Hereyoucanfindarticles

11 onturkisheatinghabitsandsomerecipesforpopularturkish mealshttp://www.turkmutfakkulturu.info/pages.php?parentid=2 ThisisaveryhelpfulsitewhichincludesashorthistoryofTurkishfood,thepopularfoodin Turkey,thenamesofthefoodsandtheirEnglishtranslations: Youcanfindvarioustypesofrecipeatthesesites:http://www.turkishcookbook.com/turkce/ media.com/yemektarifleri/http://www.e lezzet.com/ tarifi.info/english/ ThisisabeautifulsitethatincludesavideocliponTurkishcuisine: 5c8 Inthisvideo,theownerofoneofthemostfamousbaklavarestaurantsinGazianteptalksabout howtomakequalitybaklava: 4) DEĞERLENDİRME/EVALUATION Youwereableto: Needs improvement 11 Toacertain extent Good Takedetailednotesonthetheme TurkishCuisineandCulture while watchingthevideos Skimandscanarticle(s)forrelevant information. Categorizenotesunderspecified topics. Discussyourideasthroughsemistructuredcontext/discourse. Usepersuasivelanguageby combininglanguageelementsin discretesentencesandstringsof sentences Createanumberofbasic, uncomplicatedcommunicative exchanges Connectyoursentencesandideas intoparagraphsoressays,using cohesiveelements Paraphrasetheideasinthe reading/audiotext Collectdatafromavarietyofsources andcombinethemintoameaningful unit Presentyourideasinawaythatis easilyunderstoodbyanative audience Presentinformationinalogical Toagreat extent

12 sequencethataudiencescanfollow Presentinformationusing appropriate,standardgrammar Includetransitionstoconnectkey pointsinpresentingyourideas. DEĞERLENDİRME Yapabiliyorum: TürkmutfağıveKültürütemasınadair videolarıizlerkendetaylınotlar alabiliyorum. İlgilimakaleleritarayıpgözden geçirebiliyorum. Belirlikonulardanotlarımı gruplayabiliyorum. Yarıyapılandırılmışbağlamda fikirlerimitartışabiliyorum. Kısmiyadaparçacıklıcümleler halindeiknaedicibirdil kullanabiliyorum. Türkçe'debirkaçbasitveçok karmaşıkolmayankalıplarkullanarak iletişimkurabiliyorum. Çeşitlibağlaçlarkullanarakfikirve cümlelerimiparagrafyadametne dönüştürebiliyorum. Okumayadadinlememetinlerinde geçenfikirlerikendicümlelerimle yenidenkurabiliyorum. Farklıkaynaklardanveritoplayıpbu verilerianlamlıbirbütüne dönüştürebiliyorum. Fikirlerimi,Türkçe'yianadiliolarak kullananinsanlarınanlayabileceği şekildedilegetirebiliyorum. Dinleyicilerintakipedebileceğişekilde bilgiyisunabiliyorum. Standartdilbilgisikurallarını kullanarakbilgiyisunabiliyorum. Anafikirlerimianlatırkenbağlaçlar kullanabiliyorum. Geliştirilmeli Kısmen yapabiliyorum. İyiyim Oldukça iyiyim 12

13 13 5) YARDIMCITEMALAR/FOLLOW UP Youcouldexpandthe TurkishCuisineandCulture themebyreferringtotheottomancuisine, sothatahistoricalperspectivecouldbegainedandintegratedintomodernturkishcuisine.the historyofmodernturkishcuisinecouldbetiedtoottomancuisineandtheothercuisinesthat haveaffectedturkishcuisine.thiswaytheideaofdiversitycouldbeintegratedintoaseemingly modesttheme TurkishCuisineandCulture. TurkishCuisineandCulture couldalsobeextendedbyanalyzingthesocio economicfactorsin differentregionsthataffectedtheireatinghabits.therelationshipbetweenpeoples eating habitsandtheirphenomenological/anthropologicalexistencecouldbeanalyzed.also,theeffect ofgeographicalconditionsonpeoples eatinghabitsandthetypesofthefoodtheyeatcouldbe analyzed.youcouldevenprovideyourownlocalexamples. Moreover, TurkishCuisineandCulture couldbefurtheredbyreferringtothetraditionaldays andcelebrationsandthetypeoffoodthatisconsumedonthosedays.moreculturalelements couldbeintegratedintothetheme.seetheyeşilelmamovieandthepptpresentationnoii (Foodforspecialdays)orthispurpose. Finally, TurkishCuisineandCulture couldbefurtheredbytakingthecharacteristicsofseven differentregionsintoconsiderationandtalkingaboutthedifferencesand/orsimilaritiesamong theseregionswithregardtotheireatinghabitsandthetypeoffoodtheyconsume. 6) MÜZİK/MUSIC Youcanusethefollowingtypesofmusicwiththereedflute[neyinTurkish]andthelute[udin Turkish]orsomeselectionsfromclassicalTurkishmusicandTurkishfolkmusic ) KAYNAKÇA/BIBLIOGRAPHY Özbek,N.(1995).DiscourseMarkersinTurkishandEnglish:Acomparativestudy.Unpublished Ph.D.Thesis.UniversityofNottingham,UK.RetrievedOctober01,2009,from Tezcan,M.(2000).TürkYemekAntropolojisiYazıları.Ankara:KültürBakanlığıHAGEMYayınları. RetrievedSeptember17,2000,fromhttp://www.turkmutfakkulturu.info/pages.php?ParentID=2 Internetsites 1.http://www.turkmutfakkulturu.info/pages.php?ParentID=1 2.http://www.turkmutfakkulturu.info/pages.php?ParentID=1&FirstLevel=7&SecondLevel=100 3.http://e gazete.anadolu.edu.tr/ayrinti.php?no=6937

14 8) SUNUMLAR/POWERPOINTPRESENTATIONS PresentationI:InthevideoTurkishEatingHabits,thespeakers,whiletalkingabouteating habitsinturkishculture,goontotalkaboutthetypesofdrinksanddessertthatareindigenous toandpopularinturkey.inordertosupportthecontentoftheconversation,thepowerpoint presentationalcoholicandnon alcoholicdrinksinturkeyintroducesthepopulartypesof drinksthatareconsumedinturkey,mostofwhicharelocal.youcanwatchthepowerpoint afterviewingthevideointhefirstprojectorbeforethesecondprojecttogetanideaofeach drink,whicharepartofyourpresentationsforthesecondproject. PresentationII:Foodforspecialdaysisaboutthetypeoffoodconsumedonspecialoccasions. TherearemanyspecialdayscelebratedinTurkey,andpeoplehavedifferenttypeoffoodon mostofthesedays.thepowerpointpresentationintroducesthespecialdayandtypeoffood attributedtothatday.youcanmakeuseofthispowerpointasacontingencyplaniftime allocatedforproject2(presentationofdifferentturkishfood,drinks,anddesserts)isenough. Thisis,indeed,oneofthethemestofurthertheproject. 9) YARDIMCIKONUŞMAKALIPLARI/PRE ORALACTIVITY Pleaseusethefollowingstructurestofacilitatethediscussion. Presentations Türkkültüründe,yemekyemealışkanlıklarıbağlamındafarkettiğimözelliklerdenbir tanesi Diğerbelirginbirözelliğişuolabilir... Dikkatçekicinoktalardanbirtanesi,kanaatimce,şudur... Bizimkültürde(konuşmacınınkendikültürü),Türkkültüründenfarklıolarakşunlar yapılır... Bizimkültürde(konuşmacınınkendikültürü)bukonuşöyleyken(açıkla),Türkkültüründe bukonuyaşöylebakılmakta... BizimkültürdeAkonusunaşuaçıdanbakılır,ama/fakatTürkkültüründebukonu şöyledir... İkikültüründe(konuşmacınınkendikültürüveTürkkültürü)ortaközelliklerişunlar olabilir... Farklılıklarolsada,ikikültürdeA/B/Cnoktalarıbağlamındabirbirinebenzemekte... Yiyecek/içecek/tatlı/kuruyemiş.Bukonularanlatılırken(sunumesnasında)dikkatedilmesi gerekennoktalarşunlardır: bütüntürlerinhangibölgeyeyadaşehireaitolduğununbelirtilmesi; genelliklenasılvenezamantüketildiğinedairbilgiverilmesi; yiyecekveiçeceklerinmalzemelerininnelerolduğununanlatılması; varsayiyecekveiçeceklerinhangimutfaktantürkmutfağınageçtiğininbelirlenmesi; bütüntürlereaitresimler,vevarsahazırlanışşekillerinedairvideolarınsağlanması; mümkünsetürlerinbölgeninyadaşehrinsosyo ekonomikyapısı/seviyesiyle bağlantısınınaçıklanması. 14

15 EK/APPENDIXI VideoTranscriptofthemovie TurkishEatingHabits Keywords:kültür,alışkanlık,farklılık,kahvaltı,öğün,ekmek(a),çeşit,sıra,rakı,tatminetmek, misafir,tabak,israf,(misafir)ağırlamak. Conversationmarkers/connectivesandduplications Yasin:Esracığımelinesağlıkçokgüzelolmuş. Esra:Afiyetolsun. Ayşegül:Gerçektennefisolmuş. Esra:Cevizlitarçınlıyaptımsiziniçin. Yasin:Öylemi,teşekkürederiz,zahmetolmuş(bak). Ayşegül:Kokusu,rengi,herşeymükemmelolmuş. Yasin:BirankendimiziTürkiye dehissettikböyleçay vallaözlemişiz Yasin:Geçen(lerde)düşünüyordumda,böyle(hani)Amerikankültürüyle,Türkkültürü arasındaki,yemekyemealışkanlıklarıbağlamındafarklılıklarnelerolabiliryadavarmı? Esra:Varvar,meselagünebaşlarkenbizimiçinkahvaltıçokönemlidir.Kahvaltısızadımımızı dışarıatamayız.hanibazıları"kafamçalışmıyor"derhatta."çayıiçmedenkafamçalışmaz"der bazıları.başka kahvaltıdapeynirimizolur,zeytinimizolur;reçellerolurgeneldeevyapımı:çilek, (Yasin:evet)Vişne kayısı(ayşegül:güzelkokulu),şeftali,değişik,değişik. Ayşegül:Kahvaltıanaöğündüraslındabizde.Geçiştirilmemesigerekirkesinlikle. Esra:Amerika dakibrunchgibidahaçokzaten,değilmi? Yasin:Evet,çeşitlikahvaltıadlarıolsada,bizimkigibibirşeydeğil,öğünleşmemiş.Bizdeenaz akşamyemeğikadarönemlidir(aslında)kahvaltı. Ayşegül:Kesinlikle Esra:Hattakahvaltıiçinrestoranlarvardır. Yasin:Tabii,özellikle(şeyde)Van 7 daçokyaygındıro.kahvaltırestoranlarıvardır,hattainsanlar İstanbul dangiderordakahvaltıyapmaya. Esra:Bolu da 8 davarbirtane(yasin:boludağı'ndavar) Ayşegül:Kahvaltısaraylarıçokgüzeldir,(marketler);gidersin,böylebütünürünlerdizidizi.Çeşit çeşitzeytinler,beyazpeynirler,reçeller,sadecekahvaltımamülleri.başkahiçbirşeyyok,(yasin: kesinlikle)çokgüzel. Yasin:Sıcakekmekleberaber Ayşegül:Oooo,sıcakekmekdedin Esra:Fırınlardan,değilmi? Yasin:Evet Esra:Sıcaksıcak Yasin:Haniekmekokadaryaygınkibizdezatenhersokaktamutlakabirfırıngörürsünböyle; sıcakekmekyapanfırınlarvardır. Esra:Sabahleyinevinküçüklerigönderilir Yasin:Veinsanlarsırayageçer Esra: Niyehepbengidiyorum,birkeredeağabeyim(abim)gitsin. Ayşegül:"Yok,senküçüksün,seningitmenlazım." Yasin:Evet 7 AcityintheeastofTurkey. 8 AcityinthewestofTurkey. 15

16 Ayşegül:Birdeekmekçeşitleri,yanionlarıngörüntüleriböyle,başlıbaşınasanataslında.Çiçek ekmekler,somunekmekler,susamlı,haşhaşlı,(esra:kepekli)kepekli,pideler 9 Yasin:Evetonuözlüyorumben Ayşegül:Bende(çok),ogörüntüyü Yasin:Fırınkültürü,değilmi?Türkiye dede(böyle)büyükkentlerdebirazazalmayabaşladı,ama küçükkentlerde,kırsallarda,halaoşeyvar,ofırınkültürüvar.insanlarhattaşeyyaparböyle, yemekiçihazırlayıpfırınaverirler,(mesela). Ayşegül:Pide Yasin:Odavardır,evetpideyapmakiçin Esra:Fırındahadeğişikolduğuiçin (Yasin:kesinlikle) Ayşegül:Otadıevdeyapılanıntadınıasla (Yasin:vermiyor) vermiyor Yasin:Başkanelerolabilir? Ayşegül:(Yemek)Öğünlerdekiyemekyemesıramız,yanihepçorbaylabaşlamamız;kahvaltı dışındadiğeröğünlerde.(esra)çorbaylabaşlıyoruz. Yasin:Değilmi?özellikleakşamyemeklerindeçorbaylabaşlarız,arkasından(işte)anayemekler gelir,yanındasebze,yadasebzeyemeğivardır. Esra:zeytinyağlıolursebzeliler Yasin:Kesinlikle Onundışında Esra:Salatabulunurmutlaka. Yasin:Mezelervardırzatenyanında (Ayşegül:evet) Yasin:İçkikültürüpekyaygındeğil Esra:Şarapkültürüdeğil Belkiokadar,yaniFransa dakikadarbelkiyaygınolmayabiliramarakı, rakımızvardır. Yasin:Evet,özellikleböylesahilbölgelerde rakısofraları 10 davardır. Ayşegül:Rakı,beyazpeynir,kavunüçlüsü(Yasin:kesinlikle).Değilmi? Ayşegül:Birdeyemekhiçbitmezbizde.Yaniakşamyemeğiniyersin Esra:Misafirlergeldiğindeözellikle. Ayşegül:Özelliklemisafirgeldiğinde. Esra:yemektensonrabirkahveyapılır,Türkkahvesi.Ondansonra,kahvedensonrabirçay.Çayın yanındaböyle,iştetatlı,atıştırmalıkçerez.(ayşegül:kuruyemişler).ensonundameyvegetirilir. Ayşegül:Misafirkesinlikletatminedilmelidir. Yasin:Tabi,evet,misafiriboşgönderemezsinbizde. Ayşegül:Yoksaiyiağırlanmamışolurmisafir. Yasin:Aynen.Oyüzdendikkatliolmakgerekiyor.Dahadoğrusudışarıdangelenlerinbukonuda dikkatliolmasıgerekiyor. Esra:Kesinlikleaçkarnagelmelerilazım Yasin:Oobirkural,obirkural. Ayşegül:Pekhayırdemeşanslarıyokgaliba(misafirlerin).Çünkübizbirazısrarederiz. "Yemelisin Tabağınıbitirmelisin " Yasin:Evet,oçokçokönemlikesinlikle. Esra:"Şundandaal.""Bunubeğenmedinmi?" Ayşegül:Evet,eğerazyerlersebeğenmediolurlar Esra:Değilmi? Esra:Tabaktayemekbırakılmazmesela.(Yasin:evet)Bizdebirazgariptir. 9 CommonbreadtypesconsumedinTurkey. 10 Rakı:atraditionalTurkishdrink,whichisgenerallyconsumedwithmashedeggplant,aspreadmadeofyogurt seasonedwithgarlic,calamari,shrimp,fish,melon,cheese,etc. 16

17 Yasin:Hani şeyvardır israftırobırakmak(tabaktayemekbırakmak) Ayşegül:"Çöpegidecektir"diyedüşünülürveyani Yasin:Başkakültürde(dahadoğrusu)çokfazlafarketmedimbenonu,hanitabağıbitirme, tabağıboşbırakmama.birnevievsahibinesaygıyıdagösteriyor.işte"yemeğiniçoksevdim." Ayşegül:Mesela,şuanyediğimizöğününasıladlandırabiliriz?İkindiçayıderizherhalde. Esra:Öğündeğildeikindiçayıevet.Çay,yanındaböylekek,salata,kısırmesela. Yasin:Değilmi?Evet. Esra:Benyapmadımama maalesef. Ayşegül:Olsun,budagayetyeterli. Esra:Birdahakisefereyaparım. Yasin:Yemeksaatlerininasılbuluyorsunuzburada?Geneldedahastrict(katı)gibigeldi,daha oturmuş. Esra:Burada,evet,bellisaatlerdebelliöğünleryeniyor.Bizherhaldebukadar,dakikmidiyeyim, dakikdeğilizyemekkonusunda. Yasin:Dahaesnek,bizimkültürde. Ayşegül:Bizimiçinöğleyemeğisaationikiyle(12),bir(1)arasıylakısıtlıdeğilaslında.Yanion ikidenbelkidördekadarbizimiçinöğleyemeğiyenilebilir. Yasin:Kesinlikle,buradaobirazdahaşeygibigeldi. Ayşegül:Aynışeyakşamyemeğiiçindegeçerlideğilmi,Yasin?Yanialtıda,yedidebaşlasa,gece onda Esra:Dokuzakadaryemekyeniyordışarıda.(Yasin:Kesinlikle). Ayşegül:Yaon,onbir,oniki.İstanbul daonikidebilesıcakyemekbulabilirsinyani. Esra:Onunadınıbirazakşamyemeğikoymakzoramayinedeenazındanlokantalaraçıktır. Ayşegül:Menüyübulabilirsin,aynımenüyü. Yasin:Yemeklerdensonra,özelliklemisafirağırlamalarda,tatlıvardır.Kaçamazsın.Yemekten sonra,belkimeyvedenönceyadasonramutlakatatlıyenir. Esra:İçecekolarakdageneldeayran 11 çokyaygın Yasin:Evet,dahadoğrusubaşkayerdeolmayanayranyaygındırbizde. Esra:AmerikalıbirarkadaşımTürkiye yegitmişti;ayranıiçemedi;çokdeğişikgeldi. Ayşegül:Gerçektenmi?(Yasin:ciddimisin)? Esra:"Nasıliçiyorsunuzsizbunu?"dedi. Ayşegül:BenimdebirAmerikalıarkadaşımayemekhazırlamıştımbenbizimevimizde.Onun şöylebirtepkisiolmuştu ıspanakyemeğiyapmıştım,üzerineyoğurtsosu,sarımsaklı yabu yoğurtbununüzerinde,yoğurttatlıbirşeydeğilmi,meyveliyoğurtolaraktüketilmeli,amabu sebzeyemeğibununüstündeneişivar? İlkçatalıalırkençoktereddütetti. Esra:Bizyoğurdusadeyiyoruzya Buradageneldemeyveli Ayşegül:Tatlıolarak. Yasin:Bizdenİngilizce'yegecenkelimelerdenbirtanesiyoğurt,değilmi? Esra:salep 12 var;birdeboza 13 var.bunlardatürkiye deyaygınolaniçecekleramaburada bulmakbirazzor. Yasin:Evet,evet.Helesalebiçokzor Bozavesalepbizimsokaklardadasatılır,gecesesleri duyarsınız. 11 Adrinkmadeofyogurtandwater. 12 Ahotdrinkmadewithpowderedsalep,thedriedtubersofcertainorchids(Redhouseİngilizce TürkçeSözlük). 13 Thick,slightlyfermentedmilletdrink. 17

18 Esra:Onlardakışiçeceğibiraz. Yasin:Kesinlikle Muhteşemoluyor. Ayşegül:Birdeözelgünleriniçeceğidirsalepaynızamanda.Meselalisemezuniyetiiçineski arkadaşlar,eskilisemezunlarıtoplanırlar,birarayagelirler,salepgünüyaparlaristanbul da. Annemlerinsalepgünlerivardırhala.Lisedenarkadaşlarıylatoplanırlar.Pilavgünügibibirşey. Esra:Pilavgünlerivar(evetpilavgünleri) Yasin:"Gün"kavramıvar,özelliklekadınlardayaygın,erkeklerpekkatılmaz. Esra:Altıngünleri 14 var. Yasin:Neleryapılıyorgeneldeogünlerde? Esra:Altıngünlerindemantıkşu:annemdenbiliyorum,benhiçkatılmadımama. Ayşegül:Bendeaynışekilde Esra:Birazdaha(böyle)eskidenyaygınmış,şimdiyapılıyormubilmiyorum.Şimdibelkidolar günleriyapılıyordur. Ayşegül:Çokdoğrusöylüyorsun,trendeuygun. Esra:Obirazşeyböyle,evsahibineparatoplamakgibibirşey(evsahibiiçin).Evinegidilenkişiye herkesbellibirmiktarparagötürüyor.meselabiraltınakararveriyorlar,herkesbiraltın götürüyor.bubirseneboyuncabütünogünekatılanlarınevindetoplanıyor. Ayşegül:Herhaftayadaheraybirininevinegidiliyor. Esra:Meselayemekler,yemekderkenböyleatıştırmalıkkek,börek,poğaça,(kısır),salatalar çaylaservisedilir.muhabbetedilir. Yasin:Evet,birsosyalfaaliyettiraslında. Esra:Sosyalfaaliyet,evet.Yardımlaşmagibibirşey.Meselaondaşeydenbaşlanır,ençokkimin ihtiyacıvarsaondanbaşlanır. Ayşegül:Yadabazenşeyyapılır,aslındabirsıravardır,altınlarıntoplanmasırası.Amameselao aybirinindahaçokihtiyacıvardır,bilinirveosıradeğiştirilir,"bensıramısanaveriyorum"denilir mesela.çokgüzelbirdayanışmaörneğidir. Yasin:Kesinlikle Yemeklerdenönceyemeklerdensonrabizimçeşitlidilselfarklılıklarımızdavar, değilmi?yemeğebaşlarkenmeselabesmele 15 çekilmesi. Esra:Evetbesmeleylebaşlanır. Esra:Birazdahatraditional,yani (Yasin:dahageleneksel)dahagelenekselbirşey Esra:Yemeğinbereketlenmesiiçinbesmeleylebaşlanır. Yasin:Kesinlikle.Dolayısıylayemekbirnevikutsaldırbizde.Yada(hani)ekmekmeselaçok kutsaldır.yeredüştüğünde(esra:kırıntılarfalan )alırsın(ayşegül:üzerinebasılmamalıdır). Ayşegül:Birdeyeredüştüğündeöpersinoekmeği,öpüpalnınakoyarsın. Esra:İşteobirsaygıgöstergesiolarakherhalde (Ayşegül:Kesinliklekutsal) Yasin:Dolayısıylabesmeleylebaşlarız.(Esra:(Ekmektenbahsetmeyedevameder)Çöpeatılmaz meselakuşlaraveyahayvanlaraverilir. Yasin:Sonra.Yemektensonranetürşeylerkullanırız,ifadelerdebulunuruz? Ayşegül:"Ellerinesağlık,"(elinesağlık),"afiyetolsun."(Yasin:"Ziyadeolsun"),"çokgüzelolmuş," "kesenizebereket." 16 Yasin:Evet. Esra:Yemeğiyapankişiyevemeselamisafirlikteysenevsahibine,böylegüzeldileklerde bulunulur.(ayşegül:iltifat)iltifatlardabulunulur. 14 Specialsocialgatherings(mostlycommonamongwomen),atypeofasocialactivitylikeapotluck. 15 Theholywordsthataregenerallyutteredwhenstartinganactivity(inIslamiccultures). 16 Expressionsthatarecommonlyusedwhenexpressingyourgratitudetosomeone(e.g.,thehostwhomadethe dinner). 18

19 19 Ayşegül:Yemeğibeğendiğini,yemektenhoşlandığınıgöstermekiçinmemnuniyetinbirifadesi olarak. Yasin:Böyleözeldavetiyeleregiderkenbizdehediyegötürmekültürünasıldır?Yadafarklıolarak [bizneyaparız?]. Ayşegül:Benimailemde,dahaçokyakınakrabalarbirbirleriniziyaretederken,özelbirgünise eğer,dahaçokmeyvegötürürler,tatlıgötürürler(yasin:baklava),baklava,birpaketbaklava. Eğerhastaysaoziyaretedeceğininsanakolonya,(Yasin:Lokum)lokumolur(Yasin:Şeker).Evet Esra:Çiçekdegötürülür. Çiçek.Geneldesaksıdaçiçekalınır,değilmi?(Yasin:Kesinlikle) Ayşegül:Çünküöbürüölecektirzaten.Kalıcıdeğildir. Yasin:Yeninesilde,şeydevardır,(Ayşegül:Buket,Yasin:Haotarzşeyler),giderkenşarapalıp götürme,üniversiteöğrencileriarasındayaygındır. Esra:Küçükhediyelerdealınabilir.Meselabireveyenitaşınmışsabirisimutlakahediyeylegidilir. Buradadahouse warminggiftdiyorlar.amerika dadavarokültür,öylebirgelenekvar. Yasin:Anladım,çokilginç. Ayşegül:İhtiyacıolabilecekşeyler,mutfakeşyaları,küçükevaletleri Ayşegül:Esracığımellerinisağlık.Herşeymükemmeldi Esra:Yaoturuyorduknegüzel!Birçaydahakoyayım. Ayşegül:Sanırımbizartıkkaçalım. Yasin:Dersimizvarveyoğunolacağız.Evet,elinesağlık,çokçokgüzelolmuşveçokgüzeldi. Esra:Afiyetolsun. Ayşegül:Almayalımartık,bukadarçayiçtiğimizyeter. Esra:Peki,afiyetolsun. Yasin:Teşekkürederiz.Ziyadeolsun. Vocabulary(Kaynak:TürkDilKurumu, BüyükTürkçeSözlük) alışkanlık(n):birşeyealışmışolmadurumu, alışkınlık,alışmışlık,alışkı,itiyat,huy, ünsiyet;örnek:yıllarınverdiğialışkanlıkla, kendimdeneminkonuşuyorum. A.Ümit. [Habit,routine] bağlam(n):herhangibirolgudaolaylar, durumlar,ilişkilerörgüsüveyabağlantısı, kontekst;örnek:uygarlıkbağlamındabatı vedoğudiyebirayrımyapılmamaktabir bütünolarakdüşünülmektedir. A.Cemal. [Context]. farklılık(n):1.farklıolmadurumu, ayrımlılık,başkalık;örnek:evvelkilerlebu songörüşümüzarasındakifarklılıkları ölçüyorum. Y.K.Beyatlı.[Difference]. kafasıçalışmak(idiom):düşünebilmek.[to beabletocontemplateaboutsomethink]. öğün(n):1.kez,defa.2.yemekvakti; örnek:heröğüntıkabasayediğiikikatlı ekmekkadayıfıile.. H.E.Adıvar.3.Bir vakitlikyemek.[meal,withanadverbil expressionoftime]. sırayageçmek(v):hizayageçmek, sıralanmak.[togetinaqueue]. (misafir)ağırlamak(v):konuğasaygı göstererekonunhertürlürahatını, gereksiniminisağlamak,ikrametmek,izaz etmek;örnek:benikarşıladılarve ağırladılar. A.Kabaklı.[Tohost,toput somebodyup]. tereddütetmek(v):kararsızdavranmak, duraksamak;örnek:hiçtereddütetmeden maksadımıkendisineanlattım. F.R.Atay. [Tohesitate]. muhabbetetmek(v):karşılıklı,dostça konuşmak;örnek:birgeçittenziyadebir toplantıyeri.mahalleoradamuhabbet eder,konuşur,kavgaeder. H.E.Adıvar.[To haveafriendlychat]. yardımlaşma(k)(n,v):yardımlaşmakişi; örnek:ziragöçebelerinhayatıheran

20 yardımlaşmalarınıgerektirir. C.Meriç.[To aidoneanother;tohelpeachother]. bereketlenmek(v)(bereket,noun): Çoğalmak,artmak;örnek:Doksanyaşına kadaryaşamış,yoklukyüzügörmemişoğul uşaktoplansakocabirmahalleolacakkadar bereketlenmiş. M.Ş.Esendal.[Toincrease; toproliferate]. öpüpalnınakoymak(idiom):değervermek, saygıgöstermek.[tovalue,toregardinhigh esteem]. iltifat(n)(iltifattabulunmak,v):1.birine güleryüzgösterme,hatırınısorma,tatlı EK/APPENDIXII VideoTranscriptofthevideoDriedFruits,DessertsandRestaurant davranma;örnek:gençkızlarerkeklerin iltifatlarınanasılkarşılıkvereceklerini şaşırmışlardı. M.Yesari.2.İlgigösterme, rağbetetme;örnek:kimeiltifatdozunu artırırsaogerçektendebirşeylerolurdu. Ç. Altan.[Compliment]. memnuniyet(n):memnunolma,sevinç duyma,sevinme;örnek:kurutan,yakan güneşlivegölgesizvenihayetsizbirçölün ortasındabirbardakbuzlusubulanyolcu memnuniyetinihissettim. A.H.Müftüoğlu. [Contentment,satisfaction]. Keywords:ürün,elyapımı,kayısı,döner,kadayıf,işlemek(işlenmiş),kurutmak(kurutulmuş), çerez,çeşit,ikrametmek,(etrafını)kaplamak,tüketmek,kavurmak(kavrulmuş),baklava. SpeakerI(Driedfruits): BunlaryinebizimMalatya'nın 17 ürünleri.şuradanbaşlayayım.bunlarpestil 18,bunlaryine Malatya'daüretilenelyapımı.Fabrikasyondeğildir.Bunlardöner 19 dediğimiz,bukayısının döneri.şununezilerek,gülkurusudediğimizkayısınınezilerek,işlenmesindensonrabuşekil alıyor.normalkilogramolarakkesekeseyeniyor.busütlü,içindeantep 20 fıstıklarıvarbunun.o nardöneri,diğerikividöneri.ondansonra,bunlaryinekayısınınürünleri.bunormalbizim bildiğimizistimli(?)kayısı;bugülkurusu.bunlaröyleoşekildegidiyor.şunlardaaynışekilde kayısınınürünleri;üstünefındıkyapıştırdığımızatomdedikleri.budaaynışekildeiçikayısıdır,dışı Antepfıstığı.Şucevizlisi.Diğertaraftakadayıf 21 var,dolmadedikleri,kadayıfdolması;içindebal veantepfıstığıvar;dışıkadayıftırdolmaşeklinde.şudeğişikbirüründür,çokgüzelbirüründür. 17 MalatyaisacityintheeatpartofTurkey.Itisfamousforitsapricotsanddriedfruits. 18 Driedlayersoffruitpulp 19 Pressedlambroastedonalargeverticalspit 20 GaziantepisacityinthesoutheastpartofTurkey.Itisknownforaspecialtypeofnut:pistachionut(calledAntep Fıstığı) 21 Akindofsweetpastry 20

June 11, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 11, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:1 THEME:YOUTH/GENÇLİK LEVEL:Intermediate EDUCATIVEPROJECTS: 1)ReportageonyouthinTurkey 2)Learningaboutyouth schallenges

Detaylı

Kerkenes News 12, 2009, fig. 11

Kerkenes News 12, 2009, fig. 11 June17,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:8 THEME:ARCHAEOLOGYANDSCIENCE ARKEOLOJİVEBİLİM LEVEL:Advanced EDUCATIVEPROJECTS: Project1:Applyingforapermitforfilmingasite

Detaylı

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) Feb.8,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:1 THEME:YOUTH/GENÇLİK LEVEL:Intermediate FocusonLanguagedevelopedbyYasinTunç FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

Module developed by Yasin Tunç

Module developed by Yasin Tunç http://deepapproach.wceruw.org/index.html 1 May4,2012 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER11 THEME:CITIESINTURKEY/TÜRKİYE'DEKİ ŞEHİRLER LEVEL:Intermediate EDUCATIVEPROJECTS:

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTED LEARNING CARDNUMBER:2 THEME:COMICSANDCARTOONS KARİKATÜRVEMİZAH LEVEL:Intermediate EDUCATIVEPROJECTS: 1)Storytellingandroleplaying 2)Researchandcreateascenario

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) Augusut11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:2 THEME:TÜRKELSANATLARI TURKISHCRAFTSMANSHIP LEVEL:Advanced FocusonLanguagedevelopedbyEsraAlagöz FOCUSONLANGUAGEand

Detaylı

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June17,2011 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:5 THEME:VISUALARTS/GÖRSELSANATLAR LEVEL:Advanced EDUCATIVEPROJECTS: 1.InquireaboutMinyatürandEbru 2.Brainstormculturalperceptionsconveyed

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:3 THEME:LOVEANDFAMILY/AŞKVEAILE LEVEL:Intermediate EDUCATIVEPROJECTS: 1.Cross CulturalAnalysisofFamilyandSocialLife

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT http://deepapproach.wceruw.org/index.html 1 August9,2010 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:9 THEME:ENVIRONMENTALACTIVISM ÇEVREEYLEMCİLİĞİ LEVEL:Intermediate FocusonLanguagedevelopedbyCelileÖkten

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) http://deepapproach.wceruw.org/index.html 1 August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:5 THEME:TURKISHCUISINEANDCULTURE TÜRKMUTFAĞIVEMUTFAKKÜLTÜRÜ LEVEL:Intermediate

Detaylı

A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING 21/06/2011 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING PHOTOHERE (sameasinmodule) CARDNUMBER:11 THEME:TARİH/HISTORY (Osmanlıİmparatorluğu ndantürkiye Cumhuriyeti nevebugün FromtheOttoman

Detaylı

August 19, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING. http://deepapproach.wceruw.org/index.html 1

August 19, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING. http://deepapproach.wceruw.org/index.html 1 August19,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:11 THEME:TARIH/HISTORY FromtheOttomanEmpiretotheTurkishRepublic andtoday Osmanlıİmparatorluğu ndantürkiye Cumhuriyeti

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:4 THEME:REKLAMLAR/ADVERTISEMENTS LEVEL:Intermediate EDUCATIVEPROJECTS: 1:Prepareapostercomparingnewandold advertisements

Detaylı

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June17,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:9 THEME:OSMANLIMIMARISIVEMODERNMIMARLIK /OTTOMANANDMODERNARCHITECTURE LEVEL:Advanced EDUCATIVEPROJECTS: 1:StudyTopkapıPalaceanditsfunctions

Detaylı

August 15, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

August 15, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING August15,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:6 THEME:TÜRKEDEBİYATI/TURKISHLITERATURE LEVEL:Advanced EDUCATIVEPROJECTS: 1:ReflectonTurkishLiterature 2:Introduceabookandwriteaninformativeessay

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT July29,2010 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER10 THEME:PROFESSIONALBIOGRAPHIES MESLEKİÖZGEÇMİŞLER LEVEL:Intermediate FocusonLanguagedevelopedbyCendelKaraman FOCUSONLANGUAGE

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:7 THEME:SAĞLIK/HEALTH LEVEL:Intermediate EDUCATIVEPROJECTS: 1.Exploringthehealthsystem 2.Debatingideasonfolkmedicineandfolk

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING 1 June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING LANGUAGESTANDARDSBEINGDEVELOPED(See ACTFL5CsStandards) Communication(1.1):Engageinconversations, provideandobtaininformation,expressfeelings

Detaylı

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) 15/11/2010 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:1 THEME:ATURKISHTREASURE:HAZELNUT/ TÜRKİYE NİNHAZİNESİ:FINDIK LEVEL:Pre Intermediate FOCUSONLANGUAGE ModuledevelopedbyEsraAlagöz

Detaylı

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June17,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:12 THEME:TÜRKİYE'DEKİMLİKVEMİLLİYETÇİLİK/ IDENTITYANDNATIONALISMINTURKEY LEVEL:Advanced EDUCATIVEPROJECTS: 1.Identity,Segregation,andResistance:Writingastory

Detaylı

26/04/2012 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS RADYO MUHABBETLERI

26/04/2012 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS RADYO MUHABBETLERI 26/04/2012 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS RADYO MUHABBETLERI LEVEL: Pre- intermediate EDUCATIVE PROJECT: Prepare a Radio

Detaylı

LEVEL: Pre- intermediate EDUCATIVE PROJECT: Tarihi bir mekana dair sunum yapınız / Present a historical site

LEVEL: Pre- intermediate EDUCATIVE PROJECT: Tarihi bir mekana dair sunum yapınız / Present a historical site June 28, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 2 THEME: TARIHSEL VE KÜLTÜREL MIRAS HISTORICAL AND CULTURAL HERITAGE LEVEL: Pre- intermediate EDUCATIVE

Detaylı

12/10/10 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS/ RADYO MUHABBETLERİ

12/10/10 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS/ RADYO MUHABBETLERİ 12/10/10 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:4 THEME:RADIOCONVERSATIONS/RADYO MUHABBETLERİ LEVEL:Pre intermediate FOCUSONLANGUAGE ModuledevelopedbyEsraAlagöz FOCUSONLANGUAGEandMULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

Durham Research Online

Durham Research Online Durham Research Online Deposited in DRO: 18 February 2015 Version of attached le: Published Version Peer-review status of attached le: Peer-reviewed Citation for published item: Woodhead, Christine (2013)

Detaylı

21/06/2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

21/06/2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING http://deepapproach.wceruw.org/index.html 1 21/06/2011 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA) 1.BackgroundInformation Summaryofthe

Detaylı

language, culture, and professional biographies. emotions, and exchange opinions in relation with

language, culture, and professional biographies. emotions, and exchange opinions in relation with June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 10 THEME: MESLEKİ ÖZGEÇMİŞLER / PROFESSIONAL BIOGRAPHIES LEVEL: Intermediate EDUCATIVE PROJECTS: 1) The

Detaylı

Mount Nemrut lies 40 km (25 mi) north of Kahta, near Adıyaman, a city in southeast Turkey.

Mount Nemrut lies 40 km (25 mi) north of Kahta, near Adıyaman, a city in southeast Turkey. Dec62010 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING PHOTOHERE (sameasinmodule) CARDNUMBER:2 THEME:TarihselveKültürelMiras/ HistoricalandCulturalHeritage LEVEL:Intermediate FocusonlanguagedevelopedbyYasinTunç

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) August11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:9 THEME:OSMANLıMİMARİSİVEMODERN MİMARLıK/OTTOMANANDMODERNARCHITECTURE LEVEL:Advanced FocusonlanguagedevelopedbyYasinTunç

Detaylı

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June17,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:4 THEME:FILMLERVEAKTÖRLER/MOVIESAND ACTORS LEVEL:Advanced EDUCATIVEPROJECTS: 1:Writeamoviecritiqueanddiscussit 2:Introduceamovie

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:8 THEME:TURKISHCINEMA TÜRKSİNEMASI YEŞİLÇAM LEVEL:Intermediate FocusonLanguagedevelopedbyCelileÖkten FOCUSONLANGUAGE

Detaylı

İŞLETMELERDE KURUMSAL İMAJ VE OLUŞUMUNDAKİ ANA ETKENLER

İŞLETMELERDE KURUMSAL İMAJ VE OLUŞUMUNDAKİ ANA ETKENLER ANKARA ÜNİVERSİTESİ SOSYAL BİLİMLER ENSTİTÜSÜ HALKLA İLİŞKİLER VE TANITIM ANA BİLİM DALI İŞLETMELERDE KURUMSAL İMAJ VE OLUŞUMUNDAKİ ANA ETKENLER BİR ÖRNEK OLAY İNCELEMESİ: SHERATON ANKARA HOTEL & TOWERS

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) http://deepapproach.wceruw.org/index.html 1 August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTED LEARNING CARDNUMBER:5 THEME:GÖRSELSANATLAR/VISUALARTS LEVEL:Advanced FocusonLanguagedevelopedbyEsraAlagöz

Detaylı

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING PHOTOHERE (sameasinmodule) CARDNUMBER:6 THEME:TÜRKEDEBİYATI/TURKISHLITERATURE LEVEL:Advanced FocusonLanguagedevelopedbyYasinTunç

Detaylı

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS Y.DİL III.(İNG.) DKB263 3 2+0 2 3

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS Y.DİL III.(İNG.) DKB263 3 2+0 2 3 DERS BİLGİLERİ Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS Y.DİL III.(İNG.) DKB263 3 2+0 2 3 Ön Koşul Dersleri Dersin Dili Dersin Seviyesi Türkçe Lisans Dersin Türü Yüz Yüze / Seçmeli Dersin Koordinatörü

Detaylı

Açık ve Uzaktan Öğretimde Farklılaştırılmış Öğretim. Hasan UÇAR, Bilecik Şeyh Edebali Üniversitesi Doç. Dr. Alper Tolga KUMTEPE, Anadolu Üniversitesi

Açık ve Uzaktan Öğretimde Farklılaştırılmış Öğretim. Hasan UÇAR, Bilecik Şeyh Edebali Üniversitesi Doç. Dr. Alper Tolga KUMTEPE, Anadolu Üniversitesi Açık ve Uzaktan Öğretimde Farklılaştırılmış Öğretim Hasan UÇAR, Bilecik Şeyh Edebali Üniversitesi Doç. Dr. Alper Tolga KUMTEPE, Anadolu Üniversitesi Farklılaştırılmış Öğretim Adil bir seçim için herkes

Detaylı

Yangın Güvenliği Kursları Eğitim Kayıt Formu

Yangın Güvenliği Kursları Eğitim Kayıt Formu Yangın Güvenliği Kursları Eğitim Kayıt Formu Aon Global Risk Consulting Yangın Güvenliği Kursları için belirlenmiş tarihler, lokasyon, ücret bilgileri ve iletişim bilgileri bu kayıt formunda bulunmaktadır.

Detaylı

TURKISH DIAGNOSTIC TEST TURKISH DEPARTMENT

TURKISH DIAGNOSTIC TEST TURKISH DEPARTMENT TURKISH DIAGNOSTIC TEST BY TURKISH DEPARTMENT This examination is designed to measure your mastery of the Turkish language. The test is multiple choices based and is there for diagnostic purposes to assess

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) August11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:4 THEME:ADVERTISEMENTS/REKLAMLAR LEVEL:Intermediate FocusonLanguagedevelopedbyYasinTunç FOCUSONLANGUAGE andmultimedialanguageassistant(mmla)

Detaylı

Virtualmin'e Yeni Web Sitesi Host Etmek - Domain Eklemek

Virtualmin'e Yeni Web Sitesi Host Etmek - Domain Eklemek Yeni bir web sitesi tanımlamak, FTP ve Email ayarlarını ayarlamak için yapılması gerekenler Öncelikle Sol Menüden Create Virtual Server(Burdaki Virtual server ifadesi sizi yanıltmasın Reseller gibi düşünün

Detaylı

Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM

Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM Bu kaynakça çalışmasında 3 adet çağrılı konuşma, 17 adet sözlü bildiri ve 2 adet poster

Detaylı

TR2009/0136.01-02/409 Benim için İnsan Hakları «Human Rights for Me» Body of Knowledge for AC/HR Education

TR2009/0136.01-02/409 Benim için İnsan Hakları «Human Rights for Me» Body of Knowledge for AC/HR Education Benim için İnsan Hakları «Human Rights for Me» Body of Knowledge for AC/HR Education Benim için İnsan Hakları «Human Rights for Me» DVE/İHE için Bilgi Bankası FLOW CHART Overall framework: Bologna Functional

Detaylı

ALANYA HALK EĞİTİMİ MERKEZİ BAĞIMSIZ YAŞAM İÇİN YENİ YAKLAŞIMLAR ADLI GRUNDTVIG PROJEMİZ İN DÖNEM SONU BİLGİLENDİRME TOPLANTISI

ALANYA HALK EĞİTİMİ MERKEZİ BAĞIMSIZ YAŞAM İÇİN YENİ YAKLAŞIMLAR ADLI GRUNDTVIG PROJEMİZ İN DÖNEM SONU BİLGİLENDİRME TOPLANTISI ALANYA HALK EĞİTİMİ MERKEZİ BAĞIMSIZ YAŞAM İÇİN YENİ YAKLAŞIMLAR ADLI GRUNDTVIG PROJEMİZ İN DÖNEM SONU BİLGİLENDİRME TOPLANTISI ALANYA PUBLIC EDUCATION CENTRE S FINAL INFORMATIVE MEETING OF THE GRUNDTVIG

Detaylı

June 21, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 21, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June21,2011 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:10 THEME:EFSANEVEÖYKÜLER MYTHSANDLEGENDS/ LEVEL:Advanced ModuledevelopedbyEsraAlagöz FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS. İngilizce İNG115 1 3+0 3 3

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS. İngilizce İNG115 1 3+0 3 3 DERS BİLGİLERİ Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS İngilizce İNG115 1 3+0 3 3 Ön Koşul Dersleri Dersin Dili Dersin Seviyesi Dersin Türü Türkçe/ İngilize Lisans Yüz Yüze / Zorunlu Dersin

Detaylı

SOFTWARE ENGINEERS EDUCATION SOFTWARE REQUIREMENTS/ INSPECTION RESEARCH FINANCIAL INFORMATION SYSTEMS DISASTER MANAGEMENT INFORMATION SYSTEMS

SOFTWARE ENGINEERS EDUCATION SOFTWARE REQUIREMENTS/ INSPECTION RESEARCH FINANCIAL INFORMATION SYSTEMS DISASTER MANAGEMENT INFORMATION SYSTEMS SOFTWARE REQUIREMENTS/ INSPECTION SOFTWARE ENGINEERS EDUCATION RESEARCH FINANCIAL INFORMATION SYSTEMS DISASTER MANAGEMENT INFORMATION SYSTEMS SOFTWARE REQUIREMENTS/ INSPECTION Ö. Albayrak, J. C. Carver,

Detaylı

Eğitim Fakültesi, Kimya Öğretmenliği Programı, Yüzüncü Yıl Üniversitesi. 1999-2004 Eğitim Fakültesi, Kimya Öğretmenliği Lisansla

Eğitim Fakültesi, Kimya Öğretmenliği Programı, Yüzüncü Yıl Üniversitesi. 1999-2004 Eğitim Fakültesi, Kimya Öğretmenliği Lisansla Ünvanı : Yrd. Doç. Dr. Adı Soyadı : Nail İLHAN Doğum Yeri ve Tarihi : Osmaniye- 1981 Bölüm: İlköğretim Bölümü E-Posta: naililhan @ gmail.com naililhan @ kilis.edu.tr Website: http://atauni.academia.edu/naililhan

Detaylı

READING 1 3 0 3 5 WRITING 1 3 0 3 5 ORAL COMMUNICATIO N SKILLS 3 0 3 5 BASIC INFORMATION TECHNOLOGIES 3 0 3 3 INTRODUCTION TO EDUCATION 3 0 3 3

READING 1 3 0 3 5 WRITING 1 3 0 3 5 ORAL COMMUNICATIO N SKILLS 3 0 3 5 BASIC INFORMATION TECHNOLOGIES 3 0 3 3 INTRODUCTION TO EDUCATION 3 0 3 3 1 FLE103 İLERİ DİNLEME 1 LISTENING 1 3 0 3 5 1 FLE105 İLERİ OKUMA 1 READING 1 3 0 3 5 1 FLE107 İLERİ YAZMA 1 WRITING 1 3 0 3 5 1 FLE109 SÖZLÜ İLETİŞİM BECERİLERİ ORAL COMMUNICATIO N SKILLS 3 0 3 5 1 TBT101

Detaylı

T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü

T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü Sayı : B.08.0.DİG.0.17.03.06.821.04 /3825 05/05/2010 Konu : Tokyo Dünya Çocuk Resimleri Yarışması..VALİLİĞİNE (İl Milî Eğitim Müdürlüğü) Dışişleri

Detaylı

M.E.B. ENG-4 Ünite-2 STUDENTS-4 UNIT-2 My Classroom ( Sınıfım ) Classroom Language ( Sınıf Dili )

M.E.B. ENG-4 Ünite-2 STUDENTS-4 UNIT-2 My Classroom ( Sınıfım ) Classroom Language ( Sınıf Dili ) 1 M.E.B. ENG-4 Ünite-2 STUDENTS-4 UNIT-2 My Classroom ( Sınıfım ) Classroom Language ( Sınıf Dili ) FUNCTIONS ( FALİYETLER ) Asking for and giving information about classroom object ( Sınıftaki nesneler

Detaylı

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) Feb11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:6 THEME:MUSICANDMUSICIANS MÜZİKVEMÜZİSYENLER LEVEL:Intermediate ModuledevelopedbyEsraAlagöz FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

e-ledger Fields (e-defter Alanları)

e-ledger Fields (e-defter Alanları) e-ledger Fields (e-defter Alanları) Table 1: Field information of the text document (Tablo 1:Yazı Metninin Alan Bilgileri) *Bulut, Lokal Table 2: Field information of the contents in the text document

Detaylı

Kuruluşun Adı / Name of Organisation: Onay Referansı / Approval Reference: Form 13 Referansı / Form 13 Reference: Bölüm 1 Genel / Part 1: General

Kuruluşun Adı / Name of Organisation: Onay Referansı / Approval Reference: Form 13 Referansı / Form 13 Reference: Bölüm 1 Genel / Part 1: General Bölüm 1 Genel / Part 1: General Intermediate audit Change Change Continuation Continuation Kuruluşun Posta Adresi / CAMO s postal address: Kuruluşun email Adresi / CAMO s email address: Kuruluşun Yönetim

Detaylı

İTÜ DERS KATALOG FORMU (COURSE CATALOGUE FORM)

İTÜ DERS KATALOG FORMU (COURSE CATALOGUE FORM) Dersin Adı İTÜ DERS KATALOG FORMU (COURSE CATALOGUE FORM) Course Name Bilimde Önemli Anlar Great Moments in Science Ders Uygulaması, Saat/Hafta (Course Implementation, Hours/Week) Kodu Yarıyılı Kredisi

Detaylı

DERS BİLGİLERİ. Ders Kodu Yarıyıl T+U Saat Kredi AKTS. GSF için Zorunlu İngilizce AFES 101 1 15+9 0 3

DERS BİLGİLERİ. Ders Kodu Yarıyıl T+U Saat Kredi AKTS. GSF için Zorunlu İngilizce AFES 101 1 15+9 0 3 DERS BİLGİLERİ Ders Kodu Yarıyıl T+U Saat Kredi AKTS GSF için Zorunlu İngilizce AFES 101 1 15+9 0 3 Ön Koşul Dersleri Yabancı Dil Hazırlık Okulunda C Kurunu tamamlamak veya İngilizce dil seviye tespit

Detaylı

Determining some heavy metal concentrations in water and sediments samples taken from Gediz River. Title Institution / University Year

Determining some heavy metal concentrations in water and sediments samples taken from Gediz River. Title Institution / University Year CV Name: Orkide MİNARECİ Date of Birth: 15.01.1972 Academic Title: Assist. Prof. Dr. Education Programme/Department University Bachelor Master Department of Biology (Fundamental and industrial microbiology)

Detaylı

Epi Info Kullanımı AMACI: Epi Info Programı ile veri tabanı hazırlayabilme ve veri girişi yapabilme becerisi kazanmak ÖĞRENİM HEDEFLERİ Epi Info bileşenlerini tanımlayabilmek Epi Info Make View programında

Detaylı

Yangın Güvenliği Kursları Eğitim Kayıt Formu

Yangın Güvenliği Kursları Eğitim Kayıt Formu Yangın Güvenliği Kursları Eğitim Kayıt Formu Aon Global Risk Consulting Yangın Güvenliği Kursları için belirlenmiş tarihler, lokasyon, ücret bilgileri ve iletişim bilgileri bu kayıt formunda bulunmaktadır.

Detaylı

Öğrenim Durumu: Derece Bölüm/Program/Alan Üniversite Bitirme Yılı Lisans Fizik / Fen Edebiyat / Fizik Dicle Üniversitesi 2004

Öğrenim Durumu: Derece Bölüm/Program/Alan Üniversite Bitirme Yılı Lisans Fizik / Fen Edebiyat / Fizik Dicle Üniversitesi 2004 ÖZGEÇMİŞ ve ESERLER LİSTESİ Genel Bilgiler: Adı Soyadı : Cihat DEMİR Doğum Yeri ve Tarihi : Diyarbakır - 14 Haziran 1982 Yazışma Adresi : Dicle Üniversitesi Ziya Gökalp Eğitim Fakültesi İlköğretim Bölümü

Detaylı

daha çok göz önünde bulundurulabilir. Öğrencilerin dile karşı daha olumlu bir tutum geliştirmeleri ve daha homojen gruplar ile dersler yürütülebilir.

daha çok göz önünde bulundurulabilir. Öğrencilerin dile karşı daha olumlu bir tutum geliştirmeleri ve daha homojen gruplar ile dersler yürütülebilir. ÖZET Üniversite Öğrencilerinin Yabancı Dil Seviyelerinin ve Yabancı Dil Eğitim Programına Karşı Tutumlarının İncelenmesi (Aksaray Üniversitesi Örneği) Çağan YILDIRAN Niğde Üniversitesi, Sosyal Bilimler

Detaylı

Physics Education in Turkey IV. FEN BİLİMLERİ EĞİTİMİ KONGRESİ 6 / 10 / 2000 8 / 10 / 2000 ANKARA

Physics Education in Turkey IV. FEN BİLİMLERİ EĞİTİMİ KONGRESİ 6 / 10 / 2000 8 / 10 / 2000 ANKARA Physics Education in Turkey IV. FEN BİLİMLERİ EĞİTİMİ KONGRESİ 6 / 10 / 2000 8 / 10 / 2000 ANKARA Bu kaynakça çalışmasında 18 adet sözlü bildiri Arş. Gör. M. Şahin BÜLBÜL tarafından listelenmiştir. 4 th

Detaylı

Physics Education in Turkey VI. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 9 / 10 / 2004 11 / 10 / 2004 İSTANBUL

Physics Education in Turkey VI. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 9 / 10 / 2004 11 / 10 / 2004 İSTANBUL Physics Education in Turkey VI. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 9 / 10 / 2004 11 / 10 / 2004 İSTANBUL Bu kaynakça çalışmasında 19 adet sözlü bildiri Arş. Gör. M. Şahin BÜLBÜL tarafından

Detaylı

CURRICULUM VITAE. Assistant Prof. Dr. Birim BALCI

CURRICULUM VITAE. Assistant Prof. Dr. Birim BALCI CURRICULUM VITAE Assistant Prof. Dr. Birim BALCI 1- Name and Surname : Birim BALCI 2- Date of Birth : 28.07.1975 3- Department : Computer Engineering 4- Education: Degree Department University Year Bachelor

Detaylı

KANSER HASTALARINDA PALYATİF BAKIM VE DESTEK SERVİSİNDE NARKOTİK ANALJEZİK KULLANIMI

KANSER HASTALARINDA PALYATİF BAKIM VE DESTEK SERVİSİNDE NARKOTİK ANALJEZİK KULLANIMI T.C. SAĞLIK BAKANLIĞI İZMİR KATİP ÇELEBİ ÜNİVERSİTESİ ATATÜRK EĞİTİM VE ARAŞTIRMA HASTANESİ AİLE HEKİMLİĞİ KLİNİĞİ KANSER HASTALARINDA PALYATİF BAKIM VE DESTEK SERVİSİNDE NARKOTİK ANALJEZİK KULLANIMI UZMANLIK

Detaylı

Inventory of LCPs in Turkey LCP Database explained and explored

Inventory of LCPs in Turkey LCP Database explained and explored Inventory of LCPs in Turkey LCP Database explained and explored Hakan Hatipoglu Antalya, 9 October 2015 Requirements and specifications (TOR) Web based database application that will: Support Inventory

Detaylı

EFFECTIVE COMMUNICATIONS. Cengiz Hakan Aydın

EFFECTIVE COMMUNICATIONS. Cengiz Hakan Aydın EFFECTIVE COMMUNICATIONS Cengiz Hakan Aydın Communication Process Feed Forward Source e n c o Mess. Chan. d e c o Recei Feed- back d e d e Communication Types Nonverbal %60 Wri7en %10 Verbal %30 Nonverbal

Detaylı

Principles of Atatürk & History of the Turkish Atatürk İlkeleri ve İnkılâp Tarihi I revolution I

Principles of Atatürk & History of the Turkish Atatürk İlkeleri ve İnkılâp Tarihi I revolution I I I. YIL HAFTALIK DERS SAATI FBÖ 101 Z Genel Fizik I General Physics I (4+0) -4 6 FBÖ 151 Z Genel Fizik Lab. I General Physics Lab. I (0+2) -1 2 FBÖ 103 Z Genel Kimya I General Chemistry I (4+0) -4 6 FBÖ

Detaylı

Pre-inter. modules We have added four preintermediate

Pre-inter. modules We have added four preintermediate Newsletter About DATTL The Deep Approach to Turkish Teaching and Learning (DATTL) is embodied in François Victor Tochon s deep approach to language instruction that encompasses the social, cultural, demographic,

Detaylı

aldora.com.tr EXPORT PANEL CATALOGUE

aldora.com.tr EXPORT PANEL CATALOGUE aldora.com.tr EXPORT PANEL CATALOGUE ALDORA FURNITURE FACTORY Since its foundation in 2001, Aldora Furniture maintains on its steady growth on 40.000m2 covered factory area in the Industrial Zone of Kayseri

Detaylı

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS. Yüz Yüze / Zorunlu / Seçmeli

Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS. Yüz Yüze / Zorunlu / Seçmeli DERS BİLGİLERİ Ders Adı Kodu Yarıyılı T+U Saati Ulusal Kredisi AKTS İngilizce ING105 1 2+0 2 2 Ön Koşul Dersleri Dersin Dili Dersin Seviyesi Dersin Türü Türkçe Lisans Yüz Yüze / Zorunlu / Seçmeli Dersin

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) Oct27,2010 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:12 THEME:CARPETCULTURE,INTURKEYANDBEYOND HALICILIK,TÜRKİYEVEÖTESİNDE LEVEL:Intermediate FocusonLanguagedevelopedbyErikaH.Gilson

Detaylı

Deep Approach to Turkish Teaching and Learning

Deep Approach to Turkish Teaching and Learning DATTL May 2012 Deep Approach to Turkish Teaching and Learning Turkish as a Lingua Franca: Turkish is becoming a key regional language that serves as a lingua franca across Eurasian states, and this role

Detaylı

ÖZGEÇMİŞ. Derece Alan Üniversite Yıl. OrtaöğretimMatematikEğitimi BoğaziciÜniversitesi 2007

ÖZGEÇMİŞ. Derece Alan Üniversite Yıl. OrtaöğretimMatematikEğitimi BoğaziciÜniversitesi 2007 ÖZGEÇMİŞ 1. AdıSoyadı: Rukiye Didem Taylan 2. DoğumTarihi: 25 Temmuz 1984 3. Unvanı: Yrd. Doç. Dr. 4. ÖgrenimDurumu: Derece Alan Üniversite Yıl Lisans OrtaöğretimMatematikEğitimi BoğaziciÜniversitesi 2007

Detaylı

Course Information. Course name Code Term T+P Hours National Credit ECTS

Course Information. Course name Code Term T+P Hours National Credit ECTS Course Information Course name Code Term T+P Hours National Credit ECTS Reading And Speaking In English BIL221 3 4+0 4 4 Prerequisite Courses None Language Level Type English First Cycle Required / Face

Detaylı

Present continous tense

Present continous tense Present continous tense This tense is mainly used for talking about what is happening now. In English, the verb would be changed by adding the suffix ing, and using it in conjunction with the correct form

Detaylı

A UNIFIED APPROACH IN GPS ACCURACY DETERMINATION STUDIES

A UNIFIED APPROACH IN GPS ACCURACY DETERMINATION STUDIES A UNIFIED APPROACH IN GPS ACCURACY DETERMINATION STUDIES by Didem Öztürk B.S., Geodesy and Photogrammetry Department Yildiz Technical University, 2005 Submitted to the Kandilli Observatory and Earthquake

Detaylı

APPLICATION QUESTIONNAIRE. Uygulama Soru Formu

APPLICATION QUESTIONNAIRE. Uygulama Soru Formu Dr.Bruno Lange GmbH & Co. KG Willstätter Str. 11 / 40549 Düsseldorf, Germany Phone : + 49 (0)211. 52. 88. 0 Fax : + 49 (0)211. 52. 88. 124 Email : anitsch@drlange.de, APPLICATION QUESTIONNAIRE Uygulama

Detaylı

Task-based video use for the improvement of English stress and intonation, Journal of Educational and Social Research, 4/2, 227-233, 2014

Task-based video use for the improvement of English stress and intonation, Journal of Educational and Social Research, 4/2, 227-233, 2014 Ebru Atak DAMAR - ÖZGEÇMİŞ Tel: +90 (224) 294 22 47 e-mail: ebruadamar@gmail.com EĞİTİM Doktora, COMU, İngiliz Dili Eğitimi(2012-devam ediyor) Yüksek Lisans, Uludağ Üniversitesi, İngiliz Dili Eğitimi (2004)

Detaylı

ÖZGEÇMİŞ. Akdeniz Üniversitesi Eğitim Fakültesi Türkçe. Derece Alan Üniversite Yıl

ÖZGEÇMİŞ. Akdeniz Üniversitesi Eğitim Fakültesi Türkçe. Derece Alan Üniversite Yıl Yrd.Doç.Dr. ÜMİT YILDIZ Adres ÖZGEÇMİŞ Eğitimi Bölümü Kampus Antalya E-posta umit@tut.by umityildiz@akdeniz.edu.tr Telefon +902423106671 Faks - 1. Eğitim Bilgileri Derece Alan Üniversite Yıl Doktora Eğitim

Detaylı

Address : Ondokuz Mayis University, Faculty of Education, Science Education Program, Samsun, TURKEY. Degree Program University Year

Address : Ondokuz Mayis University, Faculty of Education, Science Education Program, Samsun, TURKEY. Degree Program University Year Personal Data Name : Cumhur TÜRK Date of Birth : 29.10.1983 Contact Data Address : Ondokuz Mayis University, Faculty of Education, Science Education Program, Samsun, TURKEY Phone : 03623121919 (ext: 5861)

Detaylı

WOS: Web of Science. Hasan Seçen

WOS: Web of Science. Hasan Seçen WOS: Web of Science Hasan Seçen Önce bir link bulalım Not: Kurumun aboneliği yoksa Giremezsiniz! İlk açılan sayfa: All Databases All Database kısmını görelim 3 veri tabanı görüyoruz Web of Science (1970-present)

Detaylı

LEARNING GOALS Human Rights Lessons

LEARNING GOALS Human Rights Lessons This project is co-financed by the European Union and the Republic of Turkey Benim için İnsan Hakları Human Rights for Me LEARNING GOALS Human Rights Lessons Anton Senf May 2014 This project is co-financed

Detaylı

Türk-Alman Üniversitesi. Ders Bilgi Formu

Türk-Alman Üniversitesi. Ders Bilgi Formu Türk-Alman Üniversitesi Ders Bilgi Formu Dersin Adı Dersin Kodu Dersin Yarıyılı İngilizce ENG101 1 ECTS Ders Uygulama Laboratuar Kredisi (saat/hafta) (saat/hafta) (saat/hafta) 0 3 - - Ön Koşullar Dersin

Detaylı

University Colleges. Çocuuna, ev ödevleri konusunda öyle yardm edeblrsn! Kristensen, Kitte Søndergaard. Publication date: 2010

University Colleges. Çocuuna, ev ödevleri konusunda öyle yardm edeblrsn! Kristensen, Kitte Søndergaard. Publication date: 2010 University Colleges Çocuuna, ev ödevleri konusunda öyle yardm edeblrsn! Kristensen, Kitte Søndergaard Publication date: 2010 Document Version Tidlig version også kaldet pre-print Link to publication Citation

Detaylı

INSPIRE CAPACITY BUILDING IN TURKEY

INSPIRE CAPACITY BUILDING IN TURKEY Ministry of Environment and Urbanization General Directorate of Geographical Information Systems INSPIRE CAPACITY BUILDING IN TURKEY Section Manager Department of Geographical Information Agenda Background

Detaylı

MİMARİ TASARIM 7 / ARCHITECTURAL DESIGN 7 (Diploma Projesi / Diploma Project) 2015 2016 Öğrenim Yılı Bahar Yarıyılı / 2015-2016 Academic Year Spring

MİMARİ TASARIM 7 / ARCHITECTURAL DESIGN 7 (Diploma Projesi / Diploma Project) 2015 2016 Öğrenim Yılı Bahar Yarıyılı / 2015-2016 Academic Year Spring MİMARİ TASARIM 7 / ARCHITECTURAL DESIGN 7 (Diploma Projesi / Diploma Project) 2015 2016 Öğrenim Yılı Bahar Yarıyılı / 2015-2016 Academic Year Spring Term Gr.1 ZEYTİNBURNU ODAKLI MİMARİ / KENTSEL YENİLEME

Detaylı

Exercise 2 Dialogue(Diyalog)

Exercise 2 Dialogue(Diyalog) Going Home 02: At a Duty-free Shop Hi! How are you today? Today s lesson is about At a Duty-free Shop. Let s make learning English fun! Eve Dönüş 02: Duty-free Satış Mağazasında Exercise 1 Vocabulary and

Detaylı

KANSER HASTALARINDA ANKSİYETE VE DEPRESYON BELİRTİLERİNİN DEĞERLENDİRİLMESİ UZMANLIK TEZİ. Dr. Levent ŞAHİN

KANSER HASTALARINDA ANKSİYETE VE DEPRESYON BELİRTİLERİNİN DEĞERLENDİRİLMESİ UZMANLIK TEZİ. Dr. Levent ŞAHİN T.C. SAĞLIK BAKANLIĞI İZMİR KATİP ÇELEBİ ÜNİVERSİTESİ ATATÜRK EĞİTİM VE ARAŞTIRMA HASTANESİ AİLE HEKİMLİĞİ KLİNİĞİ KANSER HASTALARINDA ANKSİYETE VE DEPRESYON BELİRTİLERİNİN DEĞERLENDİRİLMESİ UZMANLIK TEZİ

Detaylı

Physics Education in Turkey V. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 16 / 10 / 2002 18 / 10 / 2002 ANKARA

Physics Education in Turkey V. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 16 / 10 / 2002 18 / 10 / 2002 ANKARA Physics Education in Turkey V. ULUSAL FEN BİLİMLERİ VE MATEMATİK EĞİTİMİ KONGRESİ 16 / 10 / 2002 18 / 10 / 2002 ANKARA Bu kaynakça çalışmasında 30 adet sözlü 5 adet poster bildiri Arş. Gör. M. Şahin BÜLBÜL

Detaylı

KOCAELİ ÜNİVERSİTESİ KOCAELİ SAĞLIK YÜKSEKOKULU SOSYAL HİZMET BÖLÜMÜ ve UNIVERSITY COLLEGE CAPITAL (DANİMARKA) işbirliğinde

KOCAELİ ÜNİVERSİTESİ KOCAELİ SAĞLIK YÜKSEKOKULU SOSYAL HİZMET BÖLÜMÜ ve UNIVERSITY COLLEGE CAPITAL (DANİMARKA) işbirliğinde KOCAELİ ÜNİVERSİTESİ KOCAELİ SAĞLIK YÜKSEKOKULU SOSYAL HİZMET BÖLÜMÜ ve UNIVERSITY COLLEGE CAPITAL (DANİMARKA) işbirliğinde Sosyal Hizmet Öğrencileri İçin ULUSLARARASI YAZ OKULU: ÇOCUK ve GENÇLERİN TOPLUMSAL

Detaylı

YABANCI ARAŞTIRMACILAR İÇİN BİLİMSEL ARAŞTIRMA İZİN PROSEDÜRÜ

YABANCI ARAŞTIRMACILAR İÇİN BİLİMSEL ARAŞTIRMA İZİN PROSEDÜRÜ YABANCI ARAŞTIRMACILAR İÇİN BİLİMSEL ARAŞTIRMA İZİN PROSEDÜRÜ Flora elemanları ve kara avcılığı kanunu kapsamında olmayan fauna elemanları ile ilgili Türkiye de bilimsel araştırma yapmak isteyen yabancı

Detaylı

Module co- developed by Celile Ökten, Cendel Karaman, and Francois V. Tochon. Collaborators: Ayşegül Mester and Esra Alagöz.

Module co- developed by Celile Ökten, Cendel Karaman, and Francois V. Tochon. Collaborators: Ayşegül Mester and Esra Alagöz. August 19, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 3 THEME: KADINLAR / WOMEN (in the media, the society, and their professions) LEVEL: Advanced EDUCATIVE

Detaylı

ÖZGEÇMİŞ E-posta:muniseseckin@hotmail.com 0(222) 239 3750/ 1657

ÖZGEÇMİŞ E-posta:muniseseckin@hotmail.com 0(222) 239 3750/ 1657 ÖZGEÇMİŞ Eposta:muniseseckin@hotmail.com 0(222) 239 3750/ 1657 1. Adı Soyadı : Munise SEÇKİN KAPUCU 2. Doğum Tarihi : 01.03.1982 3. Unvanı : Yrd. Doç. Dr. 4. Öğrenim Durumu : Derece Alan Üniversite Yıl

Detaylı

Educational On-line Programmes for Teachers and Students

Educational On-line Programmes for Teachers and Students Educational On-line Programmes for Teachers and Students Hamit İVGİN - İstanbul Provincial Directorate of National Education ICT Coordinator & Fatih Project Coordinator in İstanbul Kasım 2014 - İSTANBUL

Detaylı

Görev Değişiklikleri. Adı Soyadı Geçerlilik Bölüm ve Görevi Eski Bölüm ve Görevi. Kütüphane Direktörlüğü Satın alma Uzman Yardımcısı 13.09.

Görev Değişiklikleri. Adı Soyadı Geçerlilik Bölüm ve Görevi Eski Bölüm ve Görevi. Kütüphane Direktörlüğü Satın alma Uzman Yardımcısı 13.09. Görev Değişiklikleri 1 Adı Soyadı Geçerlilik Bölüm ve Görevi Eski Bölüm ve Görevi BİLGE ULUTÜRK 13.09.2013 Kütüphane Direktörlüğü Satın alma Uzman Yardımcısı Kütüphane Direktörlüğü Dolaşım Hizmetleri Uzman

Detaylı

7.1. Uluslararası hakemli dergilerde yayınlanan makaleler (SCI & SSCI & Arts and Humanities)

7.1. Uluslararası hakemli dergilerde yayınlanan makaleler (SCI & SSCI & Arts and Humanities) ÖZGEÇMİŞ 1. Adı Soyadı: Mikail YALÇIN 2. Doğum Tarihi: 1985 3. Unvanı: Araştırma Görevlisi 4. Öğrenim Durumu: Derece Bölüm/Program Üniversite Yıl Lisans İlköğretim Matematik Öğretmenliği Cumhuriyet Üniversitesi

Detaylı

August 28, 11 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING

August 28, 11 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING August 28, 11 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 1 THEME: ŞAİRLER VE SİYASET/POETS AND POLITICS LEVEL: Advanced EDUCATIVE PROJECTS: 1) Research and debate

Detaylı

İTÜ DERS KATALOG FORMU (COURSE CATALOGUE FORM)

İTÜ DERS KATALOG FORMU (COURSE CATALOGUE FORM) Dersin Adı Havayolu İşletmeciliği İTÜ DERS KATALOG FORMU (COURSE CATALOGUE FORM) Course Name Airline Management Ders Uygulaması, Saat/Hafta (Course Implementation, Hours/Week) Kodu Yarıyılı Kredisi AKTS

Detaylı

Özgeçmiş (CV/Resume) Hazırlanması

Özgeçmiş (CV/Resume) Hazırlanması Özgeçmiş (CV/Resume) Hazırlanması CV (curriculum vitae): (Kısa özgeçmiş) (Kaynak: Cambridge Dictionary Online :http://dictionary.cambridge.org/ dictionary/english/cv) (In UK) A short written description

Detaylı

FAHIMEH FARJAMI OKUTMAN. Öğrenim Durumu. E-Posta Adresi : ffarjami@pirireis.edu.tr : 2165810050-1277. Telefon (İş) Adres

FAHIMEH FARJAMI OKUTMAN. Öğrenim Durumu. E-Posta Adresi : ffarjami@pirireis.edu.tr : 2165810050-1277. Telefon (İş) Adres FAHIMEH FARJAMI OKUTMAN E-Posta Adresi : ffarjami@pirireis.edu.tr Telefon (İş) Adres : 26580050-277 : Piri Reis Üniversitesi,Hazırlık Kampüsü İstasyon Mah. Hakim sk. No:3, 34940 Tuzla, İSTANBUL Öğrenim

Detaylı

LEARNING AGREEMENT FOR TRAINEESHIPS

LEARNING AGREEMENT FOR TRAINEESHIPS İsminizi yazınız. LEARNING AGREEMENT FOR TRAINEESHIPS The Trainee Last name (s) Soyadınız First name (s) adınız Date of birth Doğum tarihiniz Nationality uyruğunuz Sex [M/F] cinsiyetiniz Academic year

Detaylı