FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

Save this PDF as:
 WORD  PNG  TXT  JPG

Ebat: px
Şu sayfadan göstermeyi başlat:

Download "FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)"

Transkript

1 Augusut11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:2 THEME:TÜRKELSANATLARI TURKISHCRAFTSMANSHIP LEVEL:Advanced FocusonLanguagedevelopedbyEsraAlagöz FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA) 1.BackgroundInformation Summaryofthevideo DilliOyalar Culturetips 2.LanguageAssistance Keywordsforthevideopassagetranscribed Guidedquestions Grammar Vocabulary 3.TranscriptionandGlossary Transcriptionofthevideo Glossary 1.Backgroundinformation Summaryofthevideo DilliOyalar Inthisvideo,youwilllearnabouttheartofoya,atraditionalTurkishcraft,andthemeaningsthey convey.eminesemrahanım,whoworkedasatourguideforaperiodoftime,firstbecameinterestedin theartofoyawhenshewastravellingtothesmalltownsofturkeyandstartedcollectingthem.atfirst sheonlypaidattentiontotheircolorsandpatterns.manyyearslater,sherealizedthatshehadalarge collectionanddecidedtoresearchthehiddenmeaningseachoyaconveys,aswellastheirsocio cultural values. Culturetips 1) Efe,yiğitanlamınagelenbirkelimedir.Zeybekolarakdabilinirler.TürktarihindeBatı AnadoluyöresindeyaşadıklarıveKurtuluşSavaşı ndabüyükbaşarılargösterdikleri bilinmektedir.bugünzeybekler,danslarıylavekendineözgügiyimleriyletarihibiranıolarak yaşatılmaktadır. 2) Türkkültüründeçokdetaylıakrabalıkterimlerimevcuttur.Bunlardanbazılarınışöyle sıralayabiliriz.

2 Amca İkierkekkardeşinçocuklarınagöredurumları Teyze İkikızkardeşlerinçocuklarınagöredurumları Hala Çocuğagörebabanınkızkardeşi Dayı Çocuğagöreanneninerkekkardeşi Kayınbaba Evlilerineşlerininbabası Kaynana Evlilerineşlerininannesi Dünür:Evliçocuklarınailelerininbirbirlerinegöredurumları Elti:Evlikadınınkocasınınkardeşlerininkarıları Görümce:Evlikadınınkocasınınkızkardeşleri Kayınbirader(Kayınço):Evliçiftleregöreeşlerinerkekkardeşleri Baldız:Evliçiftlerdenerkeğegöreeşininkızkardeşleri Enişte:Teyze,halavekardeskocaları Bacanak:Kızkardeşlerleevlenenerkeklerinbirbirlerinegöredurumları 2.LanguageAssistance Keywordsforthevideopassagetranscribed Oya,yazma/yemeni,temsiletmek,motif,işlemek Guidedquestionsforthevideotodeepenlisteningcomprehension 1. EmineSemraHanım ınoyalarlatanışmasınasılolmuştur? 2. Çayır çimenoyasıhangianlamlariçerir,kimtarafındanişlenir? 3. Yaşlıoyasınınözelliklerinelerdir? 4. Negibimalzemelerdenoyayapılabilir? Grammar Grammarpoint:Clitics Theclitic kihasthreefunctions: 1. Surpriseandemphasis(Göksel&Kerslake,2005) Thestructure Okadar..dıki! isusedtoexpresssurprise,admiration,andemphasis. Example:Okadarmutlu y duki! kicanalsofollowthefullyinflectedverbstoexpresssurprise,admiration,andemphasis. Example:Okadarsinirlendiki! Neyazıkki...expressessorrow. Example:Neyazıkkionubirdahagöremeyeceğim 2. Complementizer(Göksel&Kerslake,2005) SubjectComplement Theclitic kifunctionsascomplementizerintroducingthesententialsubjectofpredicates suchas şüphesiz, belli...etc.inthesestructuresthemainverbisfullyinflectedfortense andperson. Example:Şüphesizkibirgünpişmanolacaksın. ObjectComplement Theclitic kifunctionsascomplementizerintroducingthesententialobjectofpredicates suchas biliyorum, duydum...etc.inthesestructuresthemainverbisfullyinflectedfor tenseandperson. 2

3 Example:Duydumkiüniversitesınavınıkazanmışsın. 3. Conjunction(Göksel&Kerslake,2005) Result kiisalsousedtoexpresscause resultrelationshipbetweentwoevents.bothof theverbshaveeithertheoptativesuffix (y)aortheimperativeforminthesestructures. Example:Topugetirkioynayalım. Kafesinkapısınıkapatkikuşlarkaçmasın. Theclitic kifollowingthequestionparticlemiindicatesthatthemainclause cannotbepossiblyrealized.inthosecasesthemainverbistaggedwiththeoptativesuffix. Example:Toplantıyageldimikisorunumuzuanlasın! kifollowinganegativeverbexpressesthattheactioninthemainclausecannotbe realized.themainverbismarkedwiththeoptativesuffix. Example:Hatamıbilmiyorumkidüzelteyim. Inference Iftheclitic kiisusedasaresponsetoaquestion,itexpressesthattheansweris givenasaninferencedrawnfromanobservedevent. Example: İstanbul agidiyormu? Gidiyorkieşyalarınıtopluyor. Vocabulary(Kaynak:TDK) Bilinç(a):İnsanınkendisiniveçevresinitanımayeteneği,şuur. Bilinçsizceortalıktadolaşıyordu Dilli(s):Konuşan,birşeyleranlatan. Dillioyalarbizegeçmiştenhikayeleranlatır Hitapetmek(f):seslenmek,sözyöneltmek. Sergidezevkimehitapedenbirresimbulamadım Motif(a):Yanyanagelerekbirbezemeişinioluşturanvekendibaşlarınabirerbirlikolan ögelerdenherbiri. Masaörtüsündekimotiflerverenklergözalıyordu Oya(a):Genellikleipekibrişimkullanarakiğne,mekik,tığveyafirketeileyapılanincedantel. Havlununkenarınaeflatunoyaişlemişti Sevdalanmak(f):Aşıkolmak. Bugüzelşehresevdalanmamakmümkünmü? Uçuk(renk)(s):Solgun,rengini,tazeliğini,canlılığınıveyaparlaklığınıyitirmişolan. Düğüne giderkenuçukpembebirelbisegiydi. 3.TranscriptionandGlossary Transcriptionofthevideo DİLLİOYALAR Evvelzamaniçindekalbursamaniçindeçokeskilerdeuzakdağlarıneteklerindeyaşayanbir yazmavarmış.birgünsokaktadolaşırkenyolkenarındaoturankadınlardanbirininelindekiipliği görmüş.sevdalanmış,amanesevda...ipliğigördüğünderuhuaydınlanır,göremediğindeyse geceninhüznüneboğulurmuş.ipliğingündengüneoyayadönüşüpgüzelliğinegüzellikkatması aklındançıkmazolmuş.vegelzamangitzamanbuzarifoyayıistemeyekararvermiş.köydesözü geçeniğnebuişetamamdemişveiplikleoyayıevlendirmiş.iştebuaşklabaşlamışrenkrenk, desendesenoyalarlayazmalarınbuluşması.duygularınısözedökmeyehayaetmişkadınların yaşanmışlığıylabirçokhikayeninsessizoyuncularıolmuşlar.pekisessizhayatlarınsimgesi oyalarıniçerdiğianlamlarameraksalıpbusevdanınardındansürüklenenleryokmudersiniz?var tabii.hemdekırkyıldırsürenbirsevda.hayatınıtürkiye nintanıtımıiçinrehberlikyaparak 3

4 4 geçirenvebuyoldaaltıdilöğreneneminesemraerkanhanımefendigittiğiyörelerdeki kadınlarınbaşlarındakioyalaravurulmuş. E.SemraHanım:Rehberlikyaparkenoyalaravuruldumdoğrusu.Ovakityöreyöretoplamaya başladım.tabiilkbaşlardahiçbirfikrimyoktu.sırfrengi,deseni,güzelliği,yokobukıyafetime gider,şuşunagiderfalangibibiliçsizcetopladım.senelersonrabirdedönüpbaktımkibayağıbir birikimimolmuş.vebunuhakkındaciddibirçalışmayapmayakararverdimvenekadrayazılı bilgi,belgevarsatopladım.vebugünleregeldim. İncebirsanatlaişlenmişbuoyalarsadecegözedeğil,anlamlarıylaaklavegönledehitapediyor. Meselagelinolacakgençkız çayır çimen oyasınıkayınvalidesineyapıpgönderiyorki kayınvalıdesigelinin aramızçayırçimengibihuzurlu,ferah,çiçekgibiolsun muradınıbilsin. Çınaryaprağıoyasıbilgeliklegeçenuzunbirömrüntemennisiniilmekilmekdillendirirken portakalçiçeğidoğumlaölümü,gençlikleolgunluğu,ümitlemaziyitemsiletmiş.yıllarınırehberlik yapıpkültürümüzütanıtarakgeçirmişeminesemrahanımbuseferbizleriçindillioyalarınsesi oluyor. E.SemraHanım:Biryaşlıoyası.Birkereyaşlıoyasıolduğuyemenisindenbelli.Yemenisininrengi bileuçuk,solukveçiçeklerideufacık.yaşlılardahaçokböylekoyurenklerveufakmotfler kullanıyorlarbazıyörelerde.budabirnevitoprağabakmak.bakın,buçokhoşbiroya.buda mudurnuyöresineait.adıkınalıgelinparmağı.görüyormusunuzparmakşeklindeyapmışlar bunları. Oyalardakimotiflerinçoğudoğadanalınmış.Çiçek,ağaç,yaprak,hayvanmotiflerivegeometrik şekiller.aynızamandabuilmeklerdeyapanınsevinci,kederi,acısısaklı.zirabuoyalargenellikle gelin kaynana,karı koca eltiarasındakiilişkilereatıftabulunananlamlartaşıyor.öyleki kendisinesunulanhayatşartlarındanhoşnutolamayangelinkıllıkurtoyasınıyapıptakarak meramınıanlatmayaçalışırken,kocasıveyakaynanasıylaarasıiyiolamayangelinaramızbiber gibiacıanlamınıtaşıyanbiberoyasınıdolarbaşına.mezartaşıoyasıysaaramızdakisoğukluk mezarakadardevamedecekduygusuylaişlenmişbiroyadır.paranınpulunolmadığıyokluk yıllarındaysakadınlarsapla,samanla,çikolatakağıtlarıylaişlemişleroyalarını. E.SemraHanım:Oyayapmaçeşitleriçoktur.Yanihertürlümalzemedenkadınlaroyayapar. Buradadatabibugünherkestasarımokulunagidiyoröğreniyor.Buradadakadınların tahayyülünekalmışbiriş.buradaipekkozalarınıkesiprenkrenkboyayarakoyahaline getirmişler.efendim,butekrarbirgelinoyası.nevarbununucundadikkatediyormusunuz? Kurukaranfil.Tabiikieskidengelinlerinparfümleriolmadığıiçingelinlergüzelkoksundiye karanfiloyalarıylabezeliyorlardıbütünbaşlarını. Egeyöresininbuelemeğigöznuru,ihtişamlıoyalarıysaatkılıüzerineişlenmiş.Egedeninceakla ilkgelenefelerozamanlarkıyafetlerindebuihtişamlıoyalarıkullanır,başlarınıomuzlarını, bellerinisararlarmış.bukolleksiyonunbirköşesineanılarını,yaşanmışlığınizlerinideiliştiren SemraHanım ıntekarzusukültürümüzüngençnesilleretanıtılması. E.SemraHanım:bugünekadaryaptığımbütünbuçalışmalarınneticesiolarakenbüyükarzum mademkisanatevrenseldirovakitoyasanatınıdışarı,dünyayatanıtalım.herkesoyanınne olduğunubilsin.veölmesinvedegençnesillereaktaralımyani. Adınıbilmediğimiz,yüzünügörmediğimizyürklerinparmaklarıilmeklerleduygularıbirleştirdi.Ve oyar,oyer,ohaliçinooyalaryapıldı.kimizamanbiracınınkimizamansevincinlisanıoldu. Evet,dillenmeyenanlamlarladoluhayatlarınelçileriolarakoyalarımızgeçmişimizdekiElif gelinlerin,fatmaanaların,aliefelerinyadigarları.onlarınyadigarıevlatlarımızınsabizlere emaneti. Glossary(Kaynak:TürkDilKurumu)

5 Vurulmak:Âşıkolmak,gönülkaptırmak,sevdalanmak:Kimsöylemişbeni/Süheyla ya vurulmuşumdiye O.V.Kanık. Haya(etmek):Utanmaduygusu,utanç,utanma,sıkılma. Murat:1.İstek,dilek.2.Amaç,erek,gaye:Günlerdirgelipbizimlesohbetediyorsun.Muradın nedir? N.F.Kısakürek. Temsiletmek:Belirginözellikleriyleyansıtmak,sembolüolmak:Sizintemsilettiğinizzümre busahadabellibaşlıbirroloynayacakkudrettedeğildir. Y.K.Karaosmanoğlu. Yemeni/Yazma:Kalıplabasılıpelleboyanan,kadınlarınbaşlarınabağladıklarıtülbent:Genç güzelaşçıkadınındörtörgülüuzunsaçlarısiyahbiryemeniileörtülüydü. A.Gündüz. Oya:Genellikleipekibrişimkullanarakiğne,mekik,tığveyafirketeileyapılanincedantel: Dikişe,oyayabaşladı,hanımhanımcıkyaşıyordu,memnundu. R.H.Karay. Motif:Yanyanagelerekbirbezemeişinioluşturanvekendibaşlarınabirerbirlikolan ögelerdenherbiri:halımotifi.danteldekimotifler İşlemek:İncevesüslüşeyleryapmak,nakışlamak:Paraiçinişlemediğiniiddiaedenbufakir ihtiyar,şüphesiz,sanatınınâşığıydı. M.Ş.Esendal. İlmek:Çözülmesikolaydüğüm,eğretidüğüm,ilmik:Kazakördümağladım/İlmekilmek bağladım Halktürküsü. Emanet:Birinegeçiciolarakbırakılanveteslimalınankişicekorunmasıgerekeneşya,kimse vb.,inam,vedia:emanetiolanlarburadahervakitbunlarlailgilenecekbirçırakbulurlar. S. Birsel. Meram:İstek,amaç,gaye,maksat:Benimmeramımsanayalnızbirşeysormak. Ö. Seyfettin. Tahayyül:Hayaldecanlandırma:Kapılarıyeşilsabahlaraaçılansıcaktahayyüllerledoluyaz geceleri Y.K.Beyatlı Yadigar:Birkimseyi,birolayıhatırlatannesneveyakişi,hatıra:Bireserbırakmadangeleceğe yadigâr/bırakmışımkimene,bırakmasamnezarar E.B.Koryürek. Atıftabulunmak:Göndermeyapmak. REFERENCE AND COPYRIGHT INFORMATION FOR THIS FOCUS ON LANGUAGE This Focus on Language has a copyright. It may be reproduced and distributed for educational purposes only if the following citation is included in the document: This Focus on Language was originally published on the Deep Approach website (http://deepapproach.wceruw.org/index.html) as: Alagöz,E.,andTochon,F.V.(2011).TürkElSanatları/TurkishCraftsmanship.Module2,Focuson Language,Advancedlevel.Madison,WI:WisconsinCenterforEducationResearch(WCER). herewithpermissionoftheauthorsandthepublisher,thewisconsincenterforeducation ResearchattheUniversityofWisconsin Madison. To view related modules, movies, power points, theoretical articles, Q&As, and webcasts, or to comment publically on this module in a forum of discussion, please go to and select the appropriate thumbnail. 5

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) Feb.8,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:1 THEME:YOUTH/GENÇLİK LEVEL:Intermediate FocusonLanguagedevelopedbyYasinTunç FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT http://deepapproach.wceruw.org/index.html 1 August9,2010 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:9 THEME:ENVIRONMENTALACTIVISM ÇEVREEYLEMCİLİĞİ LEVEL:Intermediate FocusonLanguagedevelopedbyCelileÖkten

Detaylı

Kerkenes News 12, 2009, fig. 11

Kerkenes News 12, 2009, fig. 11 June17,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:8 THEME:ARCHAEOLOGYANDSCIENCE ARKEOLOJİVEBİLİM LEVEL:Advanced EDUCATIVEPROJECTS: Project1:Applyingforapermitforfilmingasite

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTED LEARNING CARDNUMBER:2 THEME:COMICSANDCARTOONS KARİKATÜRVEMİZAH LEVEL:Intermediate EDUCATIVEPROJECTS: 1)Storytellingandroleplaying 2)Researchandcreateascenario

Detaylı

June 11, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 11, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:1 THEME:YOUTH/GENÇLİK LEVEL:Intermediate EDUCATIVEPROJECTS: 1)ReportageonyouthinTurkey 2)Learningaboutyouth schallenges

Detaylı

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June17,2011 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:5 THEME:VISUALARTS/GÖRSELSANATLAR LEVEL:Advanced EDUCATIVEPROJECTS: 1.InquireaboutMinyatürandEbru 2.Brainstormculturalperceptionsconveyed

Detaylı

Module developed by Yasin Tunç

Module developed by Yasin Tunç http://deepapproach.wceruw.org/index.html 1 May4,2012 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER11 THEME:CITIESINTURKEY/TÜRKİYE'DEKİ ŞEHİRLER LEVEL:Intermediate EDUCATIVEPROJECTS:

Detaylı

A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING 21/06/2011 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING PHOTOHERE (sameasinmodule) CARDNUMBER:11 THEME:TARİH/HISTORY (Osmanlıİmparatorluğu ndantürkiye Cumhuriyeti nevebugün FromtheOttoman

Detaylı

Module developed by Yasin Tunç

Module developed by Yasin Tunç http://deepapproach.wceruw.org/index.html 1 June13,2011 ADEEPAPPROACH TOTURKISHSUGGESTION CARDFORSELF DIRECTEDLEARNING CARDNUMBER:5 THEME:TURKISHCUISINEANDCULTURE TÜRKMUTFAĞIVEMUTFAKKÜLTÜRÜ LEVEL:Intermediate

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:3 THEME:LOVEANDFAMILY/AŞKVEAILE LEVEL:Intermediate EDUCATIVEPROJECTS: 1.Cross CulturalAnalysisofFamilyandSocialLife

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) http://deepapproach.wceruw.org/index.html 1 August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTED LEARNING CARDNUMBER:5 THEME:GÖRSELSANATLAR/VISUALARTS LEVEL:Advanced FocusonLanguagedevelopedbyEsraAlagöz

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT July29,2010 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER10 THEME:PROFESSIONALBIOGRAPHIES MESLEKİÖZGEÇMİŞLER LEVEL:Intermediate FocusonLanguagedevelopedbyCendelKaraman FOCUSONLANGUAGE

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) http://deepapproach.wceruw.org/index.html 1 August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:5 THEME:TURKISHCUISINEANDCULTURE TÜRKMUTFAĞIVEMUTFAKKÜLTÜRÜ LEVEL:Intermediate

Detaylı

Mount Nemrut lies 40 km (25 mi) north of Kahta, near Adıyaman, a city in southeast Turkey.

Mount Nemrut lies 40 km (25 mi) north of Kahta, near Adıyaman, a city in southeast Turkey. Dec62010 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING PHOTOHERE (sameasinmodule) CARDNUMBER:2 THEME:TarihselveKültürelMiras/ HistoricalandCulturalHeritage LEVEL:Intermediate FocusonlanguagedevelopedbyYasinTunç

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) August11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:9 THEME:OSMANLıMİMARİSİVEMODERN MİMARLıK/OTTOMANANDMODERNARCHITECTURE LEVEL:Advanced FocusonlanguagedevelopedbyYasinTunç

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) August11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:4 THEME:ADVERTISEMENTS/REKLAMLAR LEVEL:Intermediate FocusonLanguagedevelopedbyYasinTunç FOCUSONLANGUAGE andmultimedialanguageassistant(mmla)

Detaylı

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING PHOTOHERE (sameasinmodule) CARDNUMBER:6 THEME:TÜRKEDEBİYATI/TURKISHLITERATURE LEVEL:Advanced FocusonLanguagedevelopedbyYasinTunç

Detaylı

12/10/10 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS/ RADYO MUHABBETLERİ

12/10/10 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS/ RADYO MUHABBETLERİ 12/10/10 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:4 THEME:RADIOCONVERSATIONS/RADYO MUHABBETLERİ LEVEL:Pre intermediate FOCUSONLANGUAGE ModuledevelopedbyEsraAlagöz FOCUSONLANGUAGEandMULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) 15/11/2010 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:1 THEME:ATURKISHTREASURE:HAZELNUT/ TÜRKİYE NİNHAZİNESİ:FINDIK LEVEL:Pre Intermediate FOCUSONLANGUAGE ModuledevelopedbyEsraAlagöz

Detaylı

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) http://deepapproach.wceruw.org/index.html 1 August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER11 THEME:CITIESINTURKEY TÜRKIYE'DEKIŞEHIRLER LEVEL:Intermediate FocusonLanguagedevelopedbyYasinTunç

Detaylı

June 21, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 21, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June21,2011 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:10 THEME:EFSANEVEÖYKÜLER MYTHSANDLEGENDS/ LEVEL:Advanced ModuledevelopedbyEsraAlagöz FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

21/06/2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

21/06/2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING http://deepapproach.wceruw.org/index.html 1 21/06/2011 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA) 1.BackgroundInformation Summaryofthe

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:8 THEME:TURKISHCINEMA TÜRKSİNEMASI YEŞİLÇAM LEVEL:Intermediate FocusonLanguagedevelopedbyCelileÖkten FOCUSONLANGUAGE

Detaylı

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTIMEDIA LANGUAGE ASSISTANT (MMLA) Feb11,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:6 THEME:MUSICANDMUSICIANS MÜZİKVEMÜZİSYENLER LEVEL:Intermediate ModuledevelopedbyEsraAlagöz FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) August10,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:3 THEME:LOVEANDFAMILY/AŞKVEAİLE LEVEL:Intermediate FocusonLanguagedevelopedbyEsraAlagöz FOCUSONLANGUAGEand MULTIMEDIALANGUAGEASSISTANT(MMLA)

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA)

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT (MMLA) Oct27,2010 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:12 THEME:CARPETCULTURE,INTURKEYANDBEYOND HALICILIK,TÜRKİYEVEÖTESİNDE LEVEL:Intermediate FocusonLanguagedevelopedbyErikaH.Gilson

Detaylı

21/06/2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

21/06/2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING http://deepapproach.wceruw.org/index.html 1 21/06/2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:1 THEME:ŞAİRLERVESİYASET/POETSANDPOLITICS LEVEL:Advanced FocusonLanguagedevelopedbyCendelKaraman

Detaylı

Durham Research Online

Durham Research Online Durham Research Online Deposited in DRO: 18 February 2015 Version of attached le: Published Version Peer-review status of attached le: Peer-reviewed Citation for published item: Woodhead, Christine (2013)

Detaylı

August 19, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING. http://deepapproach.wceruw.org/index.html 1

August 19, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING. http://deepapproach.wceruw.org/index.html 1 August19,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:11 THEME:TARIH/HISTORY FromtheOttomanEmpiretotheTurkishRepublic andtoday Osmanlıİmparatorluğu ndantürkiye Cumhuriyeti

Detaylı

August 15, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

August 15, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING August15,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:6 THEME:TÜRKEDEBİYATI/TURKISHLITERATURE LEVEL:Advanced EDUCATIVEPROJECTS: 1:ReflectonTurkishLiterature 2:Introduceabookandwriteaninformativeessay

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:7 THEME:SAĞLIK/HEALTH LEVEL:Intermediate EDUCATIVEPROJECTS: 1.Exploringthehealthsystem 2.Debatingideasonfolkmedicineandfolk

Detaylı

26/04/2012 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS RADYO MUHABBETLERI

26/04/2012 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS RADYO MUHABBETLERI 26/04/2012 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 4 THEME: RADIO CONVERSATIONS RADYO MUHABBETLERI LEVEL: Pre- intermediate EDUCATIVE PROJECT: Prepare a Radio

Detaylı

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT

FOCUS ON LANGUAGE and MULTI MEDIA LANGUAGE ASSISTANT June21,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:7 THEME:DİNVEFELSEFE RELIGIONANDPHILOSOPHY (Sufilik,İslâmiyeteGiriş,FârâbiveÇokkültürlülük) (Sufism,IntroductiontoIslam,Farabiand

Detaylı

TURKISH DIAGNOSTIC TEST TURKISH DEPARTMENT

TURKISH DIAGNOSTIC TEST TURKISH DEPARTMENT TURKISH DIAGNOSTIC TEST BY TURKISH DEPARTMENT This examination is designed to measure your mastery of the Turkish language. The test is multiple choices based and is there for diagnostic purposes to assess

Detaylı

Yangın Güvenliği Kursları Eğitim Kayıt Formu

Yangın Güvenliği Kursları Eğitim Kayıt Formu Yangın Güvenliği Kursları Eğitim Kayıt Formu Aon Global Risk Consulting Yangın Güvenliği Kursları için belirlenmiş tarihler, lokasyon, ücret bilgileri ve iletişim bilgileri bu kayıt formunda bulunmaktadır.

Detaylı

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June13,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:4 THEME:REKLAMLAR/ADVERTISEMENTS LEVEL:Intermediate EDUCATIVEPROJECTS: 1:Prepareapostercomparingnewandold advertisements

Detaylı

e-ledger Fields (e-defter Alanları)

e-ledger Fields (e-defter Alanları) e-ledger Fields (e-defter Alanları) Table 1: Field information of the text document (Tablo 1:Yazı Metninin Alan Bilgileri) *Bulut, Lokal Table 2: Field information of the contents in the text document

Detaylı

LEARNING AGREEMENT FOR TRAINEESHIPS

LEARNING AGREEMENT FOR TRAINEESHIPS İsminizi yazınız. LEARNING AGREEMENT FOR TRAINEESHIPS The Trainee Last name (s) Soyadınız First name (s) adınız Date of birth Doğum tarihiniz Nationality uyruğunuz Sex [M/F] cinsiyetiniz Academic year

Detaylı

LEVEL: Pre- intermediate EDUCATIVE PROJECT: Tarihi bir mekana dair sunum yapınız / Present a historical site

LEVEL: Pre- intermediate EDUCATIVE PROJECT: Tarihi bir mekana dair sunum yapınız / Present a historical site June 28, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 2 THEME: TARIHSEL VE KÜLTÜREL MIRAS HISTORICAL AND CULTURAL HERITAGE LEVEL: Pre- intermediate EDUCATIVE

Detaylı

T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü

T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü T.C. MİLLİ EĞİTİM BAKANLIĞI Dış İlişkiler Genel Müdürlüğü Sayı : B.08.0.DİG.0.17.03.06.821.04 /3825 05/05/2010 Konu : Tokyo Dünya Çocuk Resimleri Yarışması..VALİLİĞİNE (İl Milî Eğitim Müdürlüğü) Dışişleri

Detaylı

ERASMUS+ ÖĞRENCİ DEĞİŞİM PROGRAMI BAŞVURU SİSTEMİ KULLANIM KILAVUZU USERS GUIDE FOR THE ERASMUS+ STUDENT EXCHANGE PROGRAM APPLICATION SYSTEM

ERASMUS+ ÖĞRENCİ DEĞİŞİM PROGRAMI BAŞVURU SİSTEMİ KULLANIM KILAVUZU USERS GUIDE FOR THE ERASMUS+ STUDENT EXCHANGE PROGRAM APPLICATION SYSTEM ERASMUS+ ÖĞRENCİ DEĞİŞİM PROGRAMI BAŞVURU SİSTEMİ KULLANIM KILAVUZU USERS GUIDE FOR THE ERASMUS+ STUDENT EXCHANGE PROGRAM APPLICATION SYSTEM GİRİŞ YAPABİLMENİZ İÇİN ÜYE OLMALISINIZ! / YOU HAVE TO FIRST

Detaylı

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING

June 17, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF DIRECTED LEARNING June17,2011 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:9 THEME:OSMANLIMIMARISIVEMODERNMIMARLIK /OTTOMANANDMODERNARCHITECTURE LEVEL:Advanced EDUCATIVEPROJECTS: 1:StudyTopkapıPalaceanditsfunctions

Detaylı

Copyright of Journal of Adnan Menderes University, Agricultural Faculty is the property of Adnan Menderes University and its content may not be copied or emailed to multiple sites or posted to a listserv

Detaylı

Copyright of Journal of Adnan Menderes University, Agricultural Faculty is the property of Adnan Menderes University and its content may not be copied or emailed to multiple sites or posted to a listserv

Detaylı

yenilik (a), sağlık (a), taşınma (a), sıkıntı (a), kalıcı (sf), yatırım (a), sorumluluk (a), girişimci (sf).

yenilik (a), sağlık (a), taşınma (a), sıkıntı (a), kalıcı (sf), yatırım (a), sorumluluk (a), girişimci (sf). December13,2010 ADEEPAPPROACHTOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING CARDNUMBER:3 THEME:Falcılık/Fortune telling LEVEL:Pre intermediate FOCUSONLANGUAGE FocusonLanguagedevelopedbyYasinTunç FOCUSONLANGUAGE

Detaylı

Lesson 53 : Passive Interrogative Form of Passive Voice

Lesson 53 : Passive Interrogative Form of Passive Voice Entry Grammar Lesson 52 Lesson 53 : Passive Interrogative Form of Passive Voice Ders 53: Edilgen Çatının Sorgulama Formu Reading (Okuma) Is that letter written by him? (Bu mektup onun tarafından mı yazılmış?)

Detaylı

Yangın Güvenliği Kursları Eğitim Kayıt Formu

Yangın Güvenliği Kursları Eğitim Kayıt Formu Yangın Güvenliği Kursları Eğitim Kayıt Formu Aon Global Risk Consulting Yangın Güvenliği Kursları için belirlenmiş tarihler, lokasyon, ücret bilgileri ve iletişim bilgileri bu kayıt formunda bulunmaktadır.

Detaylı

Web of Science GAZİ ÜNİVERSİTESİ MERKEZ KÜTÜPHANESİ

Web of Science GAZİ ÜNİVERSİTESİ MERKEZ KÜTÜPHANESİ Web of Science 1 WEB OF SCIENCE Institute for Scientific Information (ISI) tarafından üretilen, dünyanın önde gelen fen bilimleri, sosyal bilimler ile sanat ve beşeri bilimler konularındaki süreli yayınlardan

Detaylı

Lesson 45: -er, more, less Ders 45: -er, more, less

Lesson 45: -er, more, less Ders 45: -er, more, less Lesson 45: -er, more, less Ders 45: -er, more, less Reading (Okuma) Jason is more active than Kevin in the class. ( Jason sınıfta Kevin den daha aktif.) This cellphone is cheap, but that one is cheaper.

Detaylı

U3000/U3100 Mini (Linux İşletim Sistemi Yüklü. Eee PC için) Hızlı Başlangıç Kılavuzu

U3000/U3100 Mini (Linux İşletim Sistemi Yüklü. Eee PC için) Hızlı Başlangıç Kılavuzu U3000/U3100 Mini (Linux İşletim Sistemi Yüklü Eee PC için) Hızlı Başlangıç Kılavuzu ASUS_U3000_U3100_mini.indd 1 2/2/08 4:11:37 PM TR3656 Birinci Basım Ocak 2008 Copyright 2008 ASUSTeK Computers, Inc.

Detaylı

Seri kablo bağlantısında Windows95/98/ME'ten Windows 2000'e bağlantı Windows95/98/ME - NT4 bağlantısına çok benzer.

Seri kablo bağlantısında Windows95/98/ME'ten Windows 2000'e bağlantı Windows95/98/ME - NT4 bağlantısına çok benzer. Seri kablo bağlantısında Windows95/98/ME'ten Windows 2000'e bağlantı Windows95/98/ME NT4 bağlantısına çok benzer. Direkt Kablo desteğini Windows95/98'e yükledikten sonra, Windows95 for Direct Cable Client

Detaylı

Cambridge International Examinations Cambridge International General Certificate of Secondary Education

Cambridge International Examinations Cambridge International General Certificate of Secondary Education Cambridge International Examinations Cambridge International General Certificate of Secondary Education *5071475631* FIRST LANGUAGE TURKISH 0513/01 Paper 1 Reading May/June 2016 Candidates answer on the

Detaylı

TÜM ÖĞRENCİ DEĞİŞİM PROGRAMLARI (ERASMUS-MEVLANA-FARABİ) BAŞVURU AŞAMALARI AYNI SÜRECİ TAKİP ETMEKTEDİR.

TÜM ÖĞRENCİ DEĞİŞİM PROGRAMLARI (ERASMUS-MEVLANA-FARABİ) BAŞVURU AŞAMALARI AYNI SÜRECİ TAKİP ETMEKTEDİR. TÜM ÖĞRENCİ DEĞİŞİM PROGRAMLARI (ERASMUS-MEVLANA-FARABİ) BAŞVURU AŞAMALARI AYNI SÜRECİ TAKİP ETMEKTEDİR. ELİNİZDEKİ KLAVUZDA ÖRNEK OLARAK ERASMUS+ BAŞVURU SÜRECİ BELİRTİLMİŞTİR. ALL STUDENT WHO WILL APPLY

Detaylı

University Colleges. Çocuuna, ev ödevleri konusunda öyle yardm edeblrsn! Kristensen, Kitte Søndergaard. Publication date: 2010

University Colleges. Çocuuna, ev ödevleri konusunda öyle yardm edeblrsn! Kristensen, Kitte Søndergaard. Publication date: 2010 University Colleges Çocuuna, ev ödevleri konusunda öyle yardm edeblrsn! Kristensen, Kitte Søndergaard Publication date: 2010 Document Version Tidlig version også kaldet pre-print Link to publication Citation

Detaylı

2009- Acıbadem Üniversitesi, Yabancı Diller Bölümü Yabancı Diller Koordinatörü

2009- Acıbadem Üniversitesi, Yabancı Diller Bölümü Yabancı Diller Koordinatörü EĞİTİM DURUMU 1979 İstanbul Üniversitesi Edebiyat Fakültesi İngiliz Dili ve Edebiyatı, Beyazıt Pedagoji ve Sosyal Antropoloji sertifikası 1972 Kadıköy Maarif Koleji, Moda İŞ TECRÜBESİ 2009- Acıbadem Üniversitesi,

Detaylı

Büyük, Dağıtık, Veri Yoğunluklu Uygulamalarda Programlama Paradigmaları

Büyük, Dağıtık, Veri Yoğunluklu Uygulamalarda Programlama Paradigmaları Büyük, Dağıtık, Veri Yoğunluklu Uygulamalarda Programlama Paradigmaları Güven Fidan AGMLAB Bilişim Teknolojileri 18/10/11 GRID ÇALIŞTAYI 2007 1 MapReduce Nedir? Büyük data kümelerini işlemek ve oluşturmak

Detaylı

Lesson 69: Articles. Ders 69: Tanımlıklar

Lesson 69: Articles. Ders 69: Tanımlıklar Lesson 69: Articles Ders 69: Tanımlıklar Reading (Okuma) Could you open the window? (Pencereyi açar mısın? The Sun is shining. (Güneş parlıyor.) I go out only twice a month. (Ayda sadece iki kere dışarı

Detaylı

Bankalarda iç suistimaller

Bankalarda iç suistimaller Bankalarda iç suistimaller Dr. Sezer Bozkuş Kahyaoğlu CIA, CFE, CFSA, CRMA, SMMM Kurumsal Risk Yönetimi Hizmetleri Sezer.bozkus@smmbilisim.com.tr İstanbul, 21. 04. 2016 2 Sunum Planı Bankalarda iç tehditlerin

Detaylı

Pre-inter. modules We have added four preintermediate

Pre-inter. modules We have added four preintermediate Newsletter About DATTL The Deep Approach to Turkish Teaching and Learning (DATTL) is embodied in François Victor Tochon s deep approach to language instruction that encompasses the social, cultural, demographic,

Detaylı

İŞLETMELERDE KURUMSAL İMAJ VE OLUŞUMUNDAKİ ANA ETKENLER

İŞLETMELERDE KURUMSAL İMAJ VE OLUŞUMUNDAKİ ANA ETKENLER ANKARA ÜNİVERSİTESİ SOSYAL BİLİMLER ENSTİTÜSÜ HALKLA İLİŞKİLER VE TANITIM ANA BİLİM DALI İŞLETMELERDE KURUMSAL İMAJ VE OLUŞUMUNDAKİ ANA ETKENLER BİR ÖRNEK OLAY İNCELEMESİ: SHERATON ANKARA HOTEL & TOWERS

Detaylı

Görev Değişiklikleri. Adı Soyadı Geçerlilik Bölüm ve Görevi Eski Bölüm ve Görevi. Kütüphane Direktörlüğü Satın alma Uzman Yardımcısı 13.09.

Görev Değişiklikleri. Adı Soyadı Geçerlilik Bölüm ve Görevi Eski Bölüm ve Görevi. Kütüphane Direktörlüğü Satın alma Uzman Yardımcısı 13.09. Görev Değişiklikleri 1 Adı Soyadı Geçerlilik Bölüm ve Görevi Eski Bölüm ve Görevi BİLGE ULUTÜRK 13.09.2013 Kütüphane Direktörlüğü Satın alma Uzman Yardımcısı Kütüphane Direktörlüğü Dolaşım Hizmetleri Uzman

Detaylı

Cambridge International Examinations Cambridge International General Certificate of Secondary Education

Cambridge International Examinations Cambridge International General Certificate of Secondary Education Cambridge International Examinations Cambridge International General Certificate of Secondary Education *6468430870* FIRST LANGUAGE TURKISH 0513/01 Paper 1 Reading May/June 2015 Candidates answer on the

Detaylı

Sınıf İçinde ve Dışında Yaratıcı Drama

Sınıf İçinde ve Dışında Yaratıcı Drama Sekizinci Basımdan Çeviri Sınıf İçinde ve Dışında Yaratıcı Drama Çeviri Editörü Eighth Edition Creative Drama in the Classroom and Beyond Nellie McCaslin Shifra Schonmann ve Doç. Dr. Ömer Adıgüzel'in Ön

Detaylı

Istanbul Gezi Rehberi. By Halil Ersin Avci

Istanbul Gezi Rehberi. By Halil Ersin Avci Istanbul Gezi Rehberi By Halil Ersin Avci Istanbul City Guide (ingilizce) Halil Ersin AVCI - kitap Istanbul City Guide (ingilizce) * Haritalar yard m yla farkl gezi g zerg hlar n takip ederek avc, HAL

Detaylı

İSTANBUL ÜNİVERSİTESİ EDEBİYAT FAKÜLTESİ TÜRK DİLİ VE EDEBİYATI DERGİSİ (TDED) NİN YAYIN İLKELERİ VE MAKALE YAZIM KURALLARI

İSTANBUL ÜNİVERSİTESİ EDEBİYAT FAKÜLTESİ TÜRK DİLİ VE EDEBİYATI DERGİSİ (TDED) NİN YAYIN İLKELERİ VE MAKALE YAZIM KURALLARI İSTANBUL ÜNİVERSİTESİ EDEBİYAT FAKÜLTESİ TÜRK DİLİ VE EDEBİYATI DERGİSİ (TDED) NİN YAYIN İLKELERİ VE MAKALE YAZIM KURALLARI A. Yayın İlkeleri 1. TDED, İÜ Rektörlüğü nün ilân ettiği dört yayın döneminin

Detaylı

Remote Support Platform 3.2'deki yenilikler

Remote Support Platform 3.2'deki yenilikler What's New Doküman versiyonu: 1.0 2015-09-24 Doküman versiyonlarý Aşağıdaki tablo, en önemli belge değişikliklerine yönelik genel bakış sağlar. Tablo 1 Versiyon Tarih Taným 1.0 2015-09-24 Birinci versiyon

Detaylı

CONTENTS / İÇİNDEKİLER. Yaşar ŞİMŞEK Osman Fikri SERTKAYA

CONTENTS / İÇİNDEKİLER. Yaşar ŞİMŞEK Osman Fikri SERTKAYA CONTENTS / İÇİNDEKİLER Yaşar ŞİMŞEK Osman Fikri SERTKAYA HOREZM TÜRKÇESİ İLE YAPILAN KUR ÂN TERCÜMELERİNDEN MEŞHED NÜSHASI ÜZERİNE İLK BİLGİLER I PRELIMINARY INFORMATION ABOUT MESHED MANUSCRIPT, THE HOREZM

Detaylı

CERRAHİ HASTALIKLARI HEMŞİRELİĞİ

CERRAHİ HASTALIKLARI HEMŞİRELİĞİ EDİTÖRLER KURULU - EDITORIAL BOARD Dr.Neriman AKYOLCU Dr.Nurhan BAYRAKTAR Dr.Fatma ETİ ASLAN Dr.F Sevgi HATİPOĞLU Dr.Deniz ŞELİMEN Dr.Meryem YAVUZ VAN GIERSBERGEN boş SAYI EDİTÖRÜ - Prof.Dr. Deniz ŞELİMEN

Detaylı

20- Teklif edilecek cihazlar yeni, hiç kullanılmamış cihazlar olmalıdır. 21- Sistem FDA, CE, ISO, GMP Güvenlik ve Kalite Onaylarına Haiz Olmalıdır.

20- Teklif edilecek cihazlar yeni, hiç kullanılmamış cihazlar olmalıdır. 21- Sistem FDA, CE, ISO, GMP Güvenlik ve Kalite Onaylarına Haiz Olmalıdır. ŞEKER CİHAZI VE STRİBİ TEKNİK ŞARTNAMESİ 1- Kullanılan Biosensör; GDH-FAD Enzim Biosensör Olmalıdır. 2- Cihazın Alternatif Bölge Testi Özelliği Olmalıdır. 3- Örnek Türü; Arter, Ven, Kapiller Kılcal Tam

Detaylı

Islington da Pratisyen Hekimliğinizi ziyaret ettiğinizde bir tercüman istemek. Getting an interpreter when you visit your GP practice in Islington

Islington da Pratisyen Hekimliğinizi ziyaret ettiğinizde bir tercüman istemek. Getting an interpreter when you visit your GP practice in Islington Islington da Pratisyen Hekimliğinizi ziyaret ettiğinizde bir tercüman istemek Getting an interpreter when you visit your GP practice in Islington Islington daki tüm Pratisyen Hekimlikler (GP) tercümanlık

Detaylı

ERASMUS GÜZ TOPLANTISI

ERASMUS GÜZ TOPLANTISI ERASMUS GÜZ TOPLANTISI Diploma Eki Çalıştayı Prof. Dr. Süheyda Atalay 5Kasım 2010 5 Kasım 2010 ERZURUM BAŞVURU SÜRECİ VE DEĞERLENDİRME TAKVİMİ İki Aşamalı Değerlendirme Prosedürü Türk Ulusal Ajansı Avrupa

Detaylı

DİPLOMA EKİ ETİKET BAŞVURUSU: DEĞERLENDİRME 8 TEMMUZ 2013, ULUSAL AJANS / ANKARA. Prof. Dr. Süheyda ATALAY

DİPLOMA EKİ ETİKET BAŞVURUSU: DEĞERLENDİRME 8 TEMMUZ 2013, ULUSAL AJANS / ANKARA. Prof. Dr. Süheyda ATALAY T.C. Yükseköğretim Kurulu DİPLOMA EKİ ETİKET BAŞVURUSU: DEĞERLENDİRME 8 TEMMUZ 2013, ULUSAL AJANS / ANKARA Prof. Dr. Süheyda ATALAY 1 DİPLOMA EKİ ETİKETİ: DEĞERLENDİRME BAŞVURU Diploma Supplement Label

Detaylı

License. Veri Tabanı Sistemleri. Konular büyük miktarda verinin etkin biçimde tutulması ve işlenmesi. Problem Kayıt Dosyaları

License. Veri Tabanı Sistemleri. Konular büyük miktarda verinin etkin biçimde tutulması ve işlenmesi. Problem Kayıt Dosyaları License c 2002-2016 T. Uyar, Ş. Öğüdücü Veri Tabanı Sistemleri Giriş You are free to: Share copy and redistribute the material in any medium or format Adapt remix, transform, and build upon the material

Detaylı

language, culture, and professional biographies. emotions, and exchange opinions in relation with

language, culture, and professional biographies. emotions, and exchange opinions in relation with June 13, 2011 A DEEP APPROACH TO TURKISH SUGGESTION CARD FOR SELF- DIRECTED LEARNING CARD NUMBER: 10 THEME: MESLEKİ ÖZGEÇMİŞLER / PROFESSIONAL BIOGRAPHIES LEVEL: Intermediate EDUCATIVE PROJECTS: 1) The

Detaylı

Okuma: Tanıdık isim ve kelimeleri, basit cümleleri örneğin; uyarı levhalarını, işaretleri, poster ve katologları okuyabilirim.

Okuma: Tanıdık isim ve kelimeleri, basit cümleleri örneğin; uyarı levhalarını, işaretleri, poster ve katologları okuyabilirim. A1 ÖĞRENCİ (Temel Seviye Kullanıcı) ANLAMA Dinleme: Kendim, ailem ve yakın çevrem hakkında tanıdık kelimeler ve en basit cümle yapılarını yavaş yavaş ve anlaşılır biçimde konuşulduğunda anlayabilirim.

Detaylı

CmpE 320 Spring 2008 Project #2 Evaluation Criteria

CmpE 320 Spring 2008 Project #2 Evaluation Criteria CmpE 320 Spring 2008 Project #2 Evaluation Criteria General The project was evaluated in terms of the following criteria: Correctness (55 points) See Correctness Evaluation below. Document (15 points)

Detaylı

.. ÜNİVERSİTESİ UNIVERSITY ÖĞRENCİ NİHAİ RAPORU STUDENT FINAL REPORT

.. ÜNİVERSİTESİ UNIVERSITY ÖĞRENCİ NİHAİ RAPORU STUDENT FINAL REPORT .. ÜNİVERSİTESİ UNIVERSITY... /... AKADEMİK YILI... DÖNEMİ... /... ACADEMIC YEAR... TERM ÖĞRENCİ NİHAİ RAPORU STUDENT FINAL REPORT Deneyimleriniz hakkındaki bu rapor, Mevlana Değişim Programı nın amacına

Detaylı

Virtualmin'e Yeni Web Sitesi Host Etmek - Domain Eklemek

Virtualmin'e Yeni Web Sitesi Host Etmek - Domain Eklemek Yeni bir web sitesi tanımlamak, FTP ve Email ayarlarını ayarlamak için yapılması gerekenler Öncelikle Sol Menüden Create Virtual Server(Burdaki Virtual server ifadesi sizi yanıltmasın Reseller gibi düşünün

Detaylı

Dağların Kahramanı.

Dağların Kahramanı. Dağların Kahramanı www.bubutales.com This ebook is distributed under Creative Common License 3.0 http://creativecommons.org/licenses/by-nc-nd/3.0/ You are free to copy, distribute and transmit this work

Detaylı

BİLİŞİM TEKNOLOJİLERİ ALANI THE INFORMATION TECHNOLOGIES DEPARTMENT

BİLİŞİM TEKNOLOJİLERİ ALANI THE INFORMATION TECHNOLOGIES DEPARTMENT BİLİŞİM TEKNOLOJİLERİ ALANI THE INFORMATION TECHNOLOGIES DEPARTMENT Bilişim Teknolojileri Alanı THE INFORMATION TECHNOLOGIES DEPARTMENT Mesleki ortaöğretim kurumlarında eğitim verilen alanlardan birisidir.

Detaylı

languaculture, culturalcompetence, interculturalcompetence gibi yeni

languaculture, culturalcompetence, interculturalcompetence gibi yeni G Dursun Öz: dil- an eser ölçüde kültürel ög ög tir. sonucunda kültürel ögelerin sonucuna Anahtar kelimeler: Türkçe, kültür, kültürel ög Cultural Content in Textbooks Teaching Turkish as a Foreign Language

Detaylı

Lesson 18 : Do..., Don t do... Ders 18: yap, yapma

Lesson 18 : Do..., Don t do... Ders 18: yap, yapma Lesson 18 : Do..., Don t do... Ders 18: yap, yapma Reading (Okuma) Walk on this road. (Bu yoldan yürü.) Write an email to me. (Bana bir e-posta yaz.) Dance on the stage! (Sahnede dans et!) Good night,

Detaylı

Deep Approach to Turkish Teaching and Learning

Deep Approach to Turkish Teaching and Learning DATTL May 2012 Deep Approach to Turkish Teaching and Learning Turkish as a Lingua Franca: Turkish is becoming a key regional language that serves as a lingua franca across Eurasian states, and this role

Detaylı

INSAAT SANAYI ve TICARET A.S. REFERANS KATALOĞU REFERENCE CATALOGUE SEÇME PROJELER SELECTED PROJECTS III HASTANELER 1 HOSPITALS ENDÜSTRİ YAPILARI INDUSTRIAL BUILDINGS EĞİTİM YAPILARI EDUCATIONAL BUILDINGS

Detaylı

D-Link DSL 500G için ayarları

D-Link DSL 500G için ayarları Celotex 4016 YAZILIM 80-8080-8081 İLDVR HARDWARE YAZILIM 80-4500-4600 DVR2000 25 FPS YAZILIM 5050-5555-1999-80 EX-3004 YAZILIM 5555 DVR 8008--9808 YAZILIM 80-9000-9001-9002 TE-203 VE TE-20316 SVDVR YAZILIM

Detaylı

Inventory of LCPs in Turkey LCP Database explained and explored

Inventory of LCPs in Turkey LCP Database explained and explored Inventory of LCPs in Turkey LCP Database explained and explored Hakan Hatipoglu Antalya, 9 October 2015 Requirements and specifications (TOR) Web based database application that will: Support Inventory

Detaylı

IDENTITY MANAGEMENT FOR EXTERNAL USERS

IDENTITY MANAGEMENT FOR EXTERNAL USERS 1/11 Sürüm Numarası Değişiklik Tarihi Değişikliği Yapan Erman Ulusoy Açıklama İlk Sürüm IDENTITY MANAGEMENT FOR EXTERNAL USERS You can connect EXTERNAL Identity Management System (IDM) with https://selfservice.tai.com.tr/

Detaylı

YAYIN İLKELERİ VE YAZIM KURALLARI

YAYIN İLKELERİ VE YAZIM KURALLARI YAYIN İLKELERİ VE YAZIM KURALLARI Yazıların nitelikleri Cumhuriyet YERBİLİMLERİ Dergisi nde yayınlanması istemiyle gönderilecek yazıların, yerbilimlerinin herhangi bir alanında (jeoloji, maden, jeofizik,

Detaylı

Lesson 30: will, will not Ders 30: will, will not

Lesson 30: will, will not Ders 30: will, will not Lesson 30: will, will not Ders 30: will, will not Reading (Okuma) I hope you will visit me one day. ( Umuyorum bir gün beni ziyaret edeceksin ) I think your sister will like that cellphone. ( Bence kız

Detaylı

Yarışma Sınavı A ) 60 B ) 80 C ) 90 D ) 110 E ) 120. A ) 4(x + 2) B ) 2(x + 4) C ) 2 + ( x + 4) D ) 2 x + 4 E ) x + 4

Yarışma Sınavı A ) 60 B ) 80 C ) 90 D ) 110 E ) 120. A ) 4(x + 2) B ) 2(x + 4) C ) 2 + ( x + 4) D ) 2 x + 4 E ) x + 4 1 4 The price of a book is first raised by 20 TL, and then by another 30 TL. In both cases, the rate of increment is the same. What is the final price of the book? 60 80 90 110 120 2 3 5 Tim ate four more

Detaylı

ELDAŞ Elektrik Elektronik Sanayi ve Tic.A.Ş.

ELDAŞ Elektrik Elektronik Sanayi ve Tic.A.Ş. Sayfa (Page): 2/9 LVD Deney Raporu LVD Testing Report İÇİNDEKİLER (Contents) 1 Dokümantasyon Sayfa (Documentation) 1.1 DGC, Çevre Koşulları ve Sembollerin Tanımları 3 (Conditions/Power Utilized,Description

Detaylı

HÜRRİYET GAZETESİ: 1948-1953 DÖNEMİNİN YAYIN POLİTİKASI

HÜRRİYET GAZETESİ: 1948-1953 DÖNEMİNİN YAYIN POLİTİKASI T.C. ANKARA ÜNİVERSİTESİ SOSYAL BİLİMLER ENSTİTÜSÜ GAZETECİLİK ANABİLİM DALI HÜRRİYET GAZETESİ: 1948-1953 DÖNEMİNİN YAYIN POLİTİKASI Doktora Tezi Selda Bulut Tez Danışmanı Prof.Dr.Korkmaz Alemdar Ankara-2007

Detaylı

İSTANBUL TEKNİK ÜNİVERSİTESİ ELEKTRİK-ELEKTRONİK FAKÜLTESİ ÖZET FONKSİYON TABANLI GÜVENLİ BİR RFID PROTOKOLÜNÜN FPGA ÜZERİNDE GERÇEKLENMESİ

İSTANBUL TEKNİK ÜNİVERSİTESİ ELEKTRİK-ELEKTRONİK FAKÜLTESİ ÖZET FONKSİYON TABANLI GÜVENLİ BİR RFID PROTOKOLÜNÜN FPGA ÜZERİNDE GERÇEKLENMESİ İSTANBUL TEKNİK ÜNİVERSİTESİ ELEKTRİK-ELEKTRONİK FAKÜLTESİ ÖZET FONKSİYON TABANLI GÜVENLİ BİR RFID PROTOKOLÜNÜN FPGA ÜZERİNDE GERÇEKLENMESİ BİTİRME ÖDEVİ YUSUF GÖRÜM 040080379 Bölümü: Elektronik ve Haberleşme

Detaylı

Lesson 22: Why. Ders 22: Neden

Lesson 22: Why. Ders 22: Neden Lesson 22: Why Ders 22: Neden Reading (Okuma) Why are you tired? (Neden yorgunsun?) Why is your boss angry? (Patronun neden sinirli?) Why was he late? (Neden geç kaldı?) Why did she go there? (Neden oraya

Detaylı

TEST RAPORU İş No./Rapor No TR478471 Tarih:3 Haziran 2013 Sayfa 1 of 5

TEST RAPORU İş No./Rapor No TR478471 Tarih:3 Haziran 2013 Sayfa 1 of 5 TEST RAPORU İş No./Rapor No TR478471 Tarih:3 Haziran 2013 Sayfa 1 of 5 ATLASFORM SERVIS EKIP SAN VE TIC LTD ŞTI ISTOC 10 ADA NO 161 BACILAR ISTANBUL TEL: 02125013444 FAX: 02126128857 Hayri Atlas ın Dikkatine

Detaylı

APPLICATION QUESTIONNAIRE. Uygulama Soru Formu

APPLICATION QUESTIONNAIRE. Uygulama Soru Formu Dr.Bruno Lange GmbH & Co. KG Willstätter Str. 11 / 40549 Düsseldorf, Germany Phone : + 49 (0)211. 52. 88. 0 Fax : + 49 (0)211. 52. 88. 124 Email : anitsch@drlange.de, APPLICATION QUESTIONNAIRE Uygulama

Detaylı

Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM

Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM Physics Education in Turkey TÜRK FİZİK DERNEĞİ 22. ULUSLARARASI FİZİK KONGRESİ 14 / 10 /2004-17 / 10 / 2004 BODRUM Bu kaynakça çalışmasında 3 adet çağrılı konuşma, 17 adet sözlü bildiri ve 2 adet poster

Detaylı

Kıdem Tazminatı Karşılığı

Kıdem Tazminatı Karşılığı Kıdem Tazminatı Karşılığı www.pwc.com.tr 15. Çözüm Ortaklığı Platformu Ajanda Sunumun Amacı ve Kapsamı Kıdem tazminatı kavramı ve karşılıkları Kıdem tazminatı karşılıklarının aktüeryal bakış açısıyla hesaplanmasının

Detaylı

mektepleri (vocational schools), darülfünun women who greatly contributed to the social, First professional women: are shown to highlight the social

mektepleri (vocational schools), darülfünun women who greatly contributed to the social, First professional women: are shown to highlight the social Feb16,2010 ADEEPAPPROACH TOTURKISH SUGGESTIONCARDFORSELF DIRECTEDLEARNING FOCUSONLANGUAGE andmultimedialanguageassistant(mmla) CARDNUMBER:3 THEME:Women/Kadınlar LEVEL:Advanced FocusonLanguagedevelopedbyCelileÖkten

Detaylı

KANSER HASTALARINDA ANKSİYETE VE DEPRESYON BELİRTİLERİNİN DEĞERLENDİRİLMESİ UZMANLIK TEZİ. Dr. Levent ŞAHİN

KANSER HASTALARINDA ANKSİYETE VE DEPRESYON BELİRTİLERİNİN DEĞERLENDİRİLMESİ UZMANLIK TEZİ. Dr. Levent ŞAHİN T.C. SAĞLIK BAKANLIĞI İZMİR KATİP ÇELEBİ ÜNİVERSİTESİ ATATÜRK EĞİTİM VE ARAŞTIRMA HASTANESİ AİLE HEKİMLİĞİ KLİNİĞİ KANSER HASTALARINDA ANKSİYETE VE DEPRESYON BELİRTİLERİNİN DEĞERLENDİRİLMESİ UZMANLIK TEZİ

Detaylı